KEGG   Pseudomonas putida KT2440: PP_4698Help
Entry
PP_4698           CDS       T00114                                 

Gene name
folK-2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PP_4698 (folK-2)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PP_4698 (folK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5340150..5340629
Genome map
AA seq 159 aa AA seqDB search
MTIRAYVGLGSNLDAPAEQLRSALQALDQVEATRLVAASALYTSDSLLPGQPRYTNAVAA
LDTALAPLALLDALQAIENDQGRVRKERWGPRTLDLDILLFGDQVLDQPRLKVPHYHMHA
RPFVLYPLAELVPGDFRLADGRALAQLLDECPFVGLERL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgaccattcgcgcctacgtaggtctgggcagcaacctggacgcacctgccgagcagctg
cgtagcgccttgcaggcgctggaccaggtcgaagccacgcgcctggtagccgcctcggcc
ctgtacaccagcgattcgctgctgcccggccaaccgcgctacaccaatgctgtcgccgcc
ctggacaccgccctggcaccactggcattgctcgatgcgctgcaggccatcgaaaacgac
cagggccgcgtgcgcaaagagcgctggggcccacgcacgctggacctggacatcctgctg
ttcggtgaccaggtgctcgaccagccacgcctgaaagtgccgcattaccacatgcatgcc
cgcccgttcgtgctgtatccgttggccgaactggtaccgggggatttccgcctggccgat
ggccgcgccctcgcacaactgctcgacgaatgcccgttcgtcggcctggaacgcctgtag

DBGET integrated database retrieval system