KEGG   Pseudomonas putida KT2440: PP_4715Help
Entry
PP_4715           CDS       T00114                                 

Gene name
tpiA
Definition
(RefSeq) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00010  Glycolysis / Gluconeogenesis
ppu00051  Fructose and mannose metabolism
ppu00562  Inositol phosphate metabolism
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
ppu01230  Biosynthesis of amino acids
Module
ppu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_4715 (tpiA)
   00051 Fructose and mannose metabolism
    PP_4715 (tpiA)
   00562 Inositol phosphate metabolism
    PP_4715 (tpiA)
Enzymes [BR:ppu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PP_4715 (tpiA)
Exosome [BR:ppu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PP_4715 (tpiA)
  Exosomal proteins of bladder cancer cells
   PP_4715 (tpiA)
  Exosomal proteins of melanoma cells
   PP_4715 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1042365
NCBI-ProteinID: NP_746823
UniProt: Q88DV4
Position
complement(5361604..5362359)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELTKGLSNLALPSGVEVAVFPPALFINQVIDGLAGKEITV
GAQNSAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKG
LKPVLCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFADAVIAYEPVWAIGTGLTATP
QQAQDVHAAIRGQLAAEDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccctatggtagctggtaactggaaaatgcacggtacccgcgctagcgtcgct
gagctgaccaaaggcttgagtaatctcgccttgccgagcggagtggaagtcgccgtattt
ccaccggccttgttcatcaatcaggtgattgatggcctggcaggtaaagaaattactgtc
ggcgcacagaattctgctgtacaacccgaacagggtgcgctgaccggggaagttgctccc
gagcagctggttgaagcaggttgcaagttggtgttgattggccattcggagcgtcgccag
attattggtgaaaccgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggc
ttgaagccagtgctttgcataggggaaacccttgaggagcgcgaggctggcaagacgctc
gaagttgtcgggcgtcaactaagcagtatcatcgaagcattcggtgttaaggcttttgcc
gatgcagtaattgcctatgagcctgtatgggccatcggtacgggccttacggccacgcca
cagcaggcccaggatgtgcacgccgccatccgcggccagttggcggcagaagatgctgaa
gtggctgcgaaggtgcagttgctatacggcggcagcgtgaaggcggccaatgcggccgaa
ctgttcggcatgccggatatcgatgggggtctcattggtggggcttccctgaacgcagac
gaattcggtgcaatttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system