KEGG   Pseudomonas putida KT2440: PP_5288Help
Entry
PP_5288           CDS       T00114                                 

Gene name
algC
Definition
(RefSeq) phosphomannomutase/phosphoglucomutase
  KO
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_5288 (algC)
   00030 Pentose phosphate pathway
    PP_5288 (algC)
   00051 Fructose and mannose metabolism
    PP_5288 (algC)
   00052 Galactose metabolism
    PP_5288 (algC)
   00500 Starch and sucrose metabolism
    PP_5288 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PP_5288 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PP_5288 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PP_5288 (algC)
Enzymes [BR:ppu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PP_5288 (algC)
    5.4.2.8  phosphomannomutase
     PP_5288 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6035471..6036862
Genome map
AA seq 463 aa AA seqDB search
MAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDGRLS
GPMLVEQLIKGLVDAGCNVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGFKIV
IAGDTLANEQIQALLTRLKTNDLTLAQGRVEKVEILDRYFKQIVGDVKLAKKLKVVVDCG
NGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADIGLA
FDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQHGGR
ALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKTEQSA
ENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEANLTTIDGVRVDYANGWGLV
RASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcccacctggtccccgccgcattgcccgacagcattttccgcgcatatgacatccgc
ggcgtggtcggcaagacccttcacgccgaaaccgcctactggatcggccgcgccatcggc
gcgcaaagcctggcccagggcgaaccgcaggtttcggtagggcgcgatggccgcctgtcg
ggcccgatgctggtggaacagctgatcaaaggcctggtcgatgcgggctgcaacgtcagc
gacgtcggcctggtgcctaccccggcgctgtactacgcagccaacgtgctggccggcaag
tccggtgtgatgctgaccggcagccacaacccgtcggactacaacggtttcaagatcgtc
atcgccggtgacaccctggccaacgaacagatccaggccctgctgacccgcctgaaaacc
aacgacctgaccctggcccaaggccgcgtggaaaaggtcgagatcctcgaccgctacttc
aagcagatcgtcggcgacgtgaagctggcgaaaaagctcaaagtggtggtggactgcggc
aacggcgccgctggcgtggttgcaccgcaactgatcgaagccctgggctgcgaagtgatc
ccgctgttctgcgaggtcgacggcaacttccccaaccaccacccggacccgggcaagccg
gaaaacctcgaggacctgatcgccaaggtcaaggaaaccggtgccgatatcggtctggcc
ttcgacggtgacggcgaccgcgtcggcgtggtgaccaacaccggcagcatcgtctacccc
gaccgcctgctgatgctgtttgcccaggacgtgctgtcgcgcaacccgggcgccgagatc
atcttcgacgtcaaatgcacccgccgcctgaccccgttgatcgaacagcacggtggccgc
gccttgatgtggaaaaccggccattcgctgatcaagaagaagatgaagcagaccggttcg
ctgctggcaggcgagatgagcggtcacatcttcatcaaggaacgctggtacggttttgac
gacggcatctatagcgccgcgcgcctgctggagatcctcagcaagaccgagcagagcgcc
gaaaacctgtttgccgccttcccgaacgacatttccacgccggaaatcaatattgatgtg
accgacgagggtaaattcagcatcattgatgcactgcaacgcgacgccgactggggcgaa
gccaacctgaccaccatcgacggtgtgcgggtcgactacgccaacggctggggcctggtt
cgcgcctccaacaccaccccggtgctggtactgcgtttcgaggccgacagcgacgccgaa
ttgcaacgtatcaaggatgttttccgcacccagttgctgcgggtagagcctgagctgcaa
ctgccgttctga

DBGET integrated database retrieval system