KEGG   Pseudomonas putida HB3267: B479_00975Help
Entry
B479_00975        CDS       T02389                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppuh  Pseudomonas putida HB3267
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208661..210604
Genome map
AA seq 647 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDQCMKEMRE
VIRSDNMDAGLAGLIPRLEKAVLDSEQRREARMNQVSDALTALVNQLQGLPLPNDVSRPL
KKLAKKLDGGVAQSRDLPPLLGELSGLQGRALSALGKSAAEARPGFLQRLFGSREDGVQG
EPALVPLALPVAEAQPLAAPAGVDAPQPDDMDALQPLPASSASVVEALVISEPELEAPGP
ALIETAELSPAPLPQPLPDDVPAAVAIASEPPVEAGPAQTLEETFGEDGPYALPYAVEPP
YSQVAEHIEHTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAIT
DSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDTQLREHVDGLQSSVQGA
ADVDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVANMEQEALGYREHL
EEQRQKALLDPLTGLPNRAAWSERVEREMLEWQAHGGHLAMAILDLDHFKRINDSYGHLA
GDKVLKIVADQLRKRLRSHDFIARFGGEEFVLLLPQTSPAAAAQIAEMLRATVEACPFHF
KGERVVITTSIGLGAFRPGERGDQVLKRADAALYRAKESGRNRVELA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaatacctgaaaagcatcgagcagcaggaa
aagctcgagcgccgttgggacgcccgtctcgacctgctgcgtcgtggtttggtacgcagc
accctggctgccgaaggcagcgacaaggtggtggaccagtgcatgaaggaaatgcgcgag
gtcatccgcagcgacaacatggacgccggccttgccgggttgattcctcgtcttgagaag
gcggtactggactccgaacagcgtcgggaagcccgcatgaaccaggtcagcgatgcgctg
acagcgctggtcaaccagctgcaaggcctgccattgccgaacgatgtgtcgcgtccgttg
aaaaagctggcgaagaagctcgatggcggagtggcccagtcacgcgacctgccaccgttg
ctgggcgagttgagcggcttgcagggccgcgcgctgtcagccttgggcaaatcggcggcg
gaggcccgccccggcttcttgcagcgcttgttcggcagccgcgaggatggtgtgcaaggc
gagccagcgcttgtgcctctggcgctgccggttgccgaggcgcagcccttggcggcacct
gccggtgtcgatgccccgcagcccgacgacatggacgcgctacagccgctgccagcctcc
tcagcttctgttgtcgaagccctcgtaatatcggagcccgagctggaggcaccaggcccg
gcgcttatcgaaacggccgaactgtcaccagccccgctgccgcagccgctcccggacgat
gtaccggcagcggtagctatcgccagcgagccgccggttgaagcaggaccggcgcaaaca
ctcgaagaaacctttggcgaagatggcccctacgccctgccctacgcggtggagccgccc
tacagccaggttgccgagcacatcgagcacactctgatcggcttgctcgatgacctcagc
ctgccagagcgacacaaggcccaggcgctagagatgcgtgaacgcgtcgcccgcggcttg
aactggtatgagctgataccggtgctggatgacctggctgtgctcatgctggcgatcacc
gacagcggccagcacgaattcgaaacctacctgcagcagctcaacgaacgcctggaaggt
ttccagagccacctgcacgaggctagcgccggccatgccgacaacagctcagccgctcgc
gagctggatacccagctgcgtgagcacgtcgatgggttgcagagcagtgtgcaaggtgcc
gccgacgtcgacagcctcaagcacattctggaaaaccgcctggaaggtctgttggtgacc
atggatgagcacaagcatgagcgtgatcgccgcgaacaggagctggctggacgcctgcaa
gggctgtcggagcgggtggcgaacatggagcaagaggcgctcggctaccgtgagcacttg
gaagagcagcgccagaaggccttgctcgatcccctaaccggcctgcccaaccgtgcggcc
tggagcgagcgggtcgagcgcgaaatgctcgaatggcaggcacacggcggccatctggcg
atggcgatcctcgacctggaccatttcaagcgtatcaacgatagctatgggcacctggct
ggggacaaggtcttgaagatcgtcgccgaccagttgcgcaagcgcctgcgcagccatgac
ttcatcgcccggtttggcggcgaggagtttgtcctgctgctgccgcaaacctcgccggct
gccgctgcccagatagccgagatgctgagggccacggtcgaggcgtgcccgttccacttc
aagggcgaacgggtggtgatcaccacgtccatcggcctgggtgcattccgtcccggcgag
cgcggcgatcaggtgctcaagcgcgccgatgcggcgctttaccgggccaaggaatcggga
cgcaaccgtgtcgagctggcataa

DBGET integrated database retrieval system