KEGG   Pseudomonas putida HB3267: B479_01315Help
Entry
B479_01315        CDS       T02389                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00860  Porphyrin and chlorophyll metabolism
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
Module
ppuh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B479_01315
Enzymes [BR:ppuh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B479_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGA71181
UniProt: L0FEV1
Position
319602..320369
Genome map
AA seq 255 aa AA seqDB search
MSSWRLLLTRPAEDCAALAQSLAAAGVASSCLPLLAIEPVAVDNQQRLLLEGLHAFQAII
VVSKPAARLLLEQLAEAGLRPPMQGWFTVGEATAAVLQGAGVAVSVPPRGDDSEALLALP
ALHQAVAVPAPRILIVRGVGGRELLAERLAEQGASVDYLELYRRCLPAYPAGTLMRRIEA
ERLNGLVVSSGQGFEHLQQMAGADWPQLARLPLFVPSPRVADQARAAGAQQVVDCRGASA
TALLAAVQRSAAPAS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgtggcgcctgttgctgacccggcctgccgaggactgtgcggcactggcgcaa
agcctggcagcggcgggggtagccagcagctgcctgccgctgctggcaatcgagcccgtc
gctgtggacaaccagcaacgcctgttgctggaaggcctgcacgccttccaggcgatcatc
gtggtcagcaagccggcagcccgtttgttgcttgagcaattggccgaggccggcctgcgg
ccacccatgcaaggttggttcaccgtgggcgaggcgaccgccgccgtgcttcagggtgca
ggcgtggcggtgagcgtcccgccacgcggcgatgacagcgaagcgttgctggcgctgcca
gccctgcaccaggcagttgccgtgccggcaccgcggatcttgatcgttcgtggtgtggga
ggtcgcgaactgctggcagagcgtcttgcagagcaaggtgctagtgtcgattatctggaa
ctgtatcgtcgctgcctgccggcttacccggcgggcaccctgatgcgccgcatcgaagcg
gaacgcctcaatggcctggtggtcagcagtgggcagggttttgaacacttgcagcagatg
gccggcgccgattggccgcagctggcgcgtctgccgctgttcgtgcccagccctcgggtt
gccgatcaggccagggccgccggggcccaacaggttgtggattgccgtggcgccagtgcc
acggccttgctggcagccgtgcagcgcagcgctgcacctgcctcttaa

DBGET integrated database retrieval system