KEGG   Pseudomonas putida HB3267: B479_01315Help
Entry
B479_01315        CDS       T02389                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B479_01315
Enzymes [BR:ppuh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B479_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319602..320369
Genome map
AA seq 255 aa AA seqDB search
MSSWRLLLTRPAEDCAALAQSLAAAGVASSCLPLLAIEPVAVDNQQRLLLEGLHAFQAII
VVSKPAARLLLEQLAEAGLRPPMQGWFTVGEATAAVLQGAGVAVSVPPRGDDSEALLALP
ALHQAVAVPAPRILIVRGVGGRELLAERLAEQGASVDYLELYRRCLPAYPAGTLMRRIEA
ERLNGLVVSSGQGFEHLQQMAGADWPQLARLPLFVPSPRVADQARAAGAQQVVDCRGASA
TALLAAVQRSAAPAS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcgtggcgcctgttgctgacccggcctgccgaggactgtgcggcactggcgcaa
agcctggcagcggcgggggtagccagcagctgcctgccgctgctggcaatcgagcccgtc
gctgtggacaaccagcaacgcctgttgctggaaggcctgcacgccttccaggcgatcatc
gtggtcagcaagccggcagcccgtttgttgcttgagcaattggccgaggccggcctgcgg
ccacccatgcaaggttggttcaccgtgggcgaggcgaccgccgccgtgcttcagggtgca
ggcgtggcggtgagcgtcccgccacgcggcgatgacagcgaagcgttgctggcgctgcca
gccctgcaccaggcagttgccgtgccggcaccgcggatcttgatcgttcgtggtgtggga
ggtcgcgaactgctggcagagcgtcttgcagagcaaggtgctagtgtcgattatctggaa
ctgtatcgtcgctgcctgccggcttacccggcgggcaccctgatgcgccgcatcgaagcg
gaacgcctcaatggcctggtggtcagcagtgggcagggttttgaacacttgcagcagatg
gccggcgccgattggccgcagctggcgcgtctgccgctgttcgtgcccagccctcgggtt
gccgatcaggccagggccgccggggcccaacaggttgtggattgccgtggcgccagtgcc
acggccttgctggcagccgtgcagcgcagcgctgcacctgcctcttaa

DBGET integrated database retrieval system