KEGG   Pseudomonas putida HB3267: B479_01760Help
Entry
B479_01760        CDS       T02389                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00521  Streptomycin biosynthesis
ppuh00523  Polyketide sugar unit biosynthesis
ppuh01130  Biosynthesis of antibiotics
Module
ppuh_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    B479_01760
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B479_01760
Enzymes [BR:ppuh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     B479_01760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom COG2
Motif
Other DBs
NCBI-ProteinID: AGA71268
UniProt: L0FE96
Position
complement(413505..414050)
Genome map
AA seq 181 aa AA seqDB search
MNIIPTAIPEVLIIEPKVFGDSRGFFFEAFNAREFARQTGVKAEFVQDNHSRSIKGVLRG
LHYQVENTQGKLVRVVQGEIRDIAVDVRKSSPTFGQWVAVQLSADNHRQLWIPPGFAHGF
AVMSESAEFLYKTTDYYNPGADRCIRWDDPTLAIDWGLQQPPVLSDKDKLGLPLAEAELL
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcatccctaccgcgatccctgaagtactgatcatcgagccgaaggttttcggt
gacagccgtggttttttcttcgaggcattcaacgcccgcgagttcgcccggcaaaccggc
gtgaaggccgagttcgtccaggacaaccactcgcgctccatcaagggtgtcctgcgtggc
ctgcactaccaggtggaaaacacccaaggcaagctggtgcgcgtggtgcagggggaaatc
cgtgatattgccgtggacgtgcgcaagagctcgccaaccttcggccaatgggtcgcggtg
cagctgtcggccgacaatcatcgccagttatggattccaccaggctttgcccacggcttt
gcggtgatgagcgagtcggccgagttcctctacaagaccaccgactactacaacccgggt
gccgaccgctgcatccgctgggatgacccgacgctggccatcgactgggggctgcagcag
ccaccggtgctgtcggacaaggacaagctcggcctgccgctggcagaggcggaactgcta
ccttaa

DBGET integrated database retrieval system