KEGG   Pseudomonas putida HB3267: B479_03230Help
Entry
B479_03230        CDS       T02389                                 

Definition
aldehyde dehydrogenase
Orthology
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B479_03230
   00620 Pyruvate metabolism
    B479_03230
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     B479_03230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(734309..735829)
Genome map
AA seq 506 aa AA seqDB search
MRYAHPGTEGAKVSFKSRYGNYIGGEFVPPVKGQYFENTSPVNGKLIAEFPRSTAEDIDK
ALDAAHAAADAWGRTSVQDRSNVLLKIADRIEQNLELLAITETWDNGKPIRETLNADIPL
AVDHFRYFAGCIRAQEGGAAEINEGTVAYHIHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPLGITVLLEVIGDLLPPGVLNVVQGYGREAGEALATSKRIAKIAFTG
STPVGSHIMKCAAENIIPSTVELGGKSPNVYFEDIMQAEPSFIEKAAEGMVLAFFNQGEV
CTCPSRALVQESIYPQFMEVVMKKVLQIKRGDPLDTDTMVGAQASQQQFEKILSYLDIAQ
KEGAELLTGGKVEKLEGSLATGYYIQPTLLKGNNKMRVFQEEIFGPVVSVTTFKDEAEAL
AIANDTEFGLGAGVWTRDINRAYRVGRGIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRET
HKMMLDHYQQTKNLLVSYDINPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacgcacatcccggtaccgaaggcgcgaaggtttccttcaagagccgctacggc
aactacatcggtggtgagttcgttcctccggtaaaggggcagtacttcgaaaatacctcc
ccggtgaatggcaagctgatcgctgaattccctcgctccactgccgaagacatcgataaa
gccctggatgcagcccacgctgcggccgacgcctggggccgcacttcagtgcaggaccgc
tccaacgttctgctgaagatcgccgaccgtatcgagcagaacctcgaactgctggccatt
accgaaacctgggacaacggcaagccgatccgcgaaaccctcaatgccgacattccgctg
gcggtcgaccacttccgctacttcgctggctgcatccgcgcccaggaaggcggcgccgcg
gaaatcaacgaaggcaccgtggcctaccacatccatgagccactgggcgtggtcgggcag
atcatcccgtggaacttcccgatcctgatggccgcctggaagctcgccccggcactggcc
gccggcaactgcgtggtgctcaagccagccgaacagaccccgctgggcatcaccgtgctg
ctggaagtgatcggtgacctgctgccacctggtgtgctcaacgtggtgcaaggctatggc
cgcgaagccggtgaagcactggccaccagcaagcgcatcgccaagatcgccttcaccggc
tcgaccccggtgggctcgcacatcatgaaatgcgccgccgagaacatcatcccgtccacc
gtcgaactgggcggcaagtcgccgaacgtgtatttcgaagacatcatgcaagccgaacca
agcttcatcgagaaggcggccgaaggcatggtgctggcgttcttcaaccagggcgaggta
tgcacctgcccgtcacgggcactggtgcaggagtcgatctacccgcagttcatggaagtg
gtgatgaagaaggtgctgcagatcaagcgcggcgacccgctggacactgacaccatggtc
ggagcgcaggcctcgcaacagcagttcgagaagatcctgtcgtacctggatatcgcccag
aaggaaggcgccgagttgctgaccggcggcaaggtcgaaaaactggagggctcgctggcc
accggttactacatccagccgaccctgctcaagggcaacaacaagatgcgcgtgttccag
gaagaaatcttcggcccggtggtcagcgtcaccaccttcaaggacgaagccgaagccctg
gcgatcgccaacgacaccgagttcggcctgggcgccggcgtgtggacccgcgacatcaac
cgtgcctaccgcgtgggccgtgggatcaaggctggccgcgtgtggaccaactgctaccac
ctgtacccggcgcatgccgcgttcggtggctacaagaagtcgggggtcgggcgtgagacg
cacaagatgatgctcgaccactatcagcagaccaagaacctgctggtgagctacgacatc
aatccgttgggcttcttctaa

DBGET integrated database retrieval system