KEGG   Pseudomonas putida HB3267: B479_03760Help
Entry
B479_03760        CDS       T02389                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00260  Glycine, serine and threonine metabolism
ppuh00750  Vitamin B6 metabolism
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01230  Biosynthesis of amino acids
Module
ppuh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B479_03760
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B479_03760
Enzymes [BR:ppuh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B479_03760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AGA71668
UniProt: L0FFB5
Position
859637..861025
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTAVPTFSQQDIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRALVSDSYRGFKHRGIAPLQQIGHNEWILQLFHGPTRSSKDFAAQLQA
RLIRHFLGPDCERVMLVGASNGDTAVAAIEALRHCPTARLLALYPSAGTPADRAAVMRSA
ASESVSCVAVDGSFDDCQSLVSALLRAWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEDCGELSIGNRQWLHARMLFDSY
AVDDALIREEIVTLFQETGCAVDPHAATGAFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPACGVGSAGVGPLLAPEDLAGVHEILARLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggttgatttccgcacggcgctgctt
tccgggctggccgacgatggcgggctttacgtgccgactgcggtgccgacgttcagccag
caggatattgccagctggtcgtggttgccgttcgacgaactggcctggcgggtaatggcg
ccgtttgtcggcgacacgctcgatgagccgaccctgagagcgctggtaagcgacagctac
cgcggcttcaagcaccgtggcatcgcaccgttgcagcagattggccataacgaatggatc
ctgcagctgtttcacgggcctacccgttcctccaaggatttcgccgcgcaattgcaggcg
cggctcatccgccatttcctgggccccgattgcgaacgggtcatgctggtcggtgccagc
aacggcgatacggcggtggccgctatcgaagccttgcggcattgccctacggcacgcttg
ctggcgctttaccccagtgccgggacaccggccgaccgggcggcggtgatgcgcagtgcc
gcttccgaaagcgtgagctgcgtggccgtggacggcagcttcgatgactgccagtcactg
gtgtcggcgctgctgcgtgcatggccgtgccccgggctgattcccgtgagcttcaactcg
accaactgggtcggcgtgctggcgcagatcgtgttctatttccacgcggcgcttcagctg
ggtggtgggattcggccggtgggtttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccaatcaaccagatcattgtttccaccaac
cgcaacgatgccttgcaccggttcatccactgcaatcgctacagccgtggctccaccagc
cagaccttgtcgccggtcatggacttttcgctgttctccaacctggaacgtttcgtctgg
gagctgtatgaccgcgatggtggcgcgacccgggcactgatggagcatttcgaggattgt
ggcgagttgagcatcggcaaccgccagtggctgcacgcgcgcatgctgttcgactcctat
gccgtggatgacgcgctgattcgcgaagaaatcgtcacgctgttccaggaaaccggctgc
gcagtagacccacacgctgccaccggggcattcgccgggcgcctgcaccggcgcaacatt
ggtgcgccgatcgtcacgctgggccagtttgccccggaaaagtctgccgggttgctggcg
gagcttggggcctggcatggcgaggtgccggcctgtggtgttggcagcgcaggcgttggg
ccgctgctggcgccagaggacctggcgggggttcatgaaatactggcccggttgcaggca
ggacgatga

DBGET integrated database retrieval system