KEGG   Pseudomonas putida HB3267: B479_03760Help
Entry
B479_03760        CDS       T02389                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppuh01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ppuh00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ppuh00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859637..861025
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTAVPTFSQQDIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRALVSDSYRGFKHRGIAPLQQIGHNEWILQLFHGPTRSSKDFAAQLQA
RLIRHFLGPDCERVMLVGASNGDTAVAAIEALRHCPTARLLALYPSAGTPADRAAVMRSA
ASESVSCVAVDGSFDDCQSLVSALLRAWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEDCGELSIGNRQWLHARMLFDSY
AVDDALIREEIVTLFQETGCAVDPHAATGAFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPACGVGSAGVGPLLAPEDLAGVHEILARLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggttgatttccgcacggcgctgctt
tccgggctggccgacgatggcgggctttacgtgccgactgcggtgccgacgttcagccag
caggatattgccagctggtcgtggttgccgttcgacgaactggcctggcgggtaatggcg
ccgtttgtcggcgacacgctcgatgagccgaccctgagagcgctggtaagcgacagctac
cgcggcttcaagcaccgtggcatcgcaccgttgcagcagattggccataacgaatggatc
ctgcagctgtttcacgggcctacccgttcctccaaggatttcgccgcgcaattgcaggcg
cggctcatccgccatttcctgggccccgattgcgaacgggtcatgctggtcggtgccagc
aacggcgatacggcggtggccgctatcgaagccttgcggcattgccctacggcacgcttg
ctggcgctttaccccagtgccgggacaccggccgaccgggcggcggtgatgcgcagtgcc
gcttccgaaagcgtgagctgcgtggccgtggacggcagcttcgatgactgccagtcactg
gtgtcggcgctgctgcgtgcatggccgtgccccgggctgattcccgtgagcttcaactcg
accaactgggtcggcgtgctggcgcagatcgtgttctatttccacgcggcgcttcagctg
ggtggtgggattcggccggtgggtttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccaatcaaccagatcattgtttccaccaac
cgcaacgatgccttgcaccggttcatccactgcaatcgctacagccgtggctccaccagc
cagaccttgtcgccggtcatggacttttcgctgttctccaacctggaacgtttcgtctgg
gagctgtatgaccgcgatggtggcgcgacccgggcactgatggagcatttcgaggattgt
ggcgagttgagcatcggcaaccgccagtggctgcacgcgcgcatgctgttcgactcctat
gccgtggatgacgcgctgattcgcgaagaaatcgtcacgctgttccaggaaaccggctgc
gcagtagacccacacgctgccaccggggcattcgccgggcgcctgcaccggcgcaacatt
ggtgcgccgatcgtcacgctgggccagtttgccccggaaaagtctgccgggttgctggcg
gagcttggggcctggcatggcgaggtgccggcctgtggtgttggcagcgcaggcgttggg
ccgctgctggcgccagaggacctggcgggggttcatgaaatactggcccggttgcaggca
ggacgatga

DBGET integrated database retrieval system