KEGG   Pseudomonas putida HB3267: B479_03890Help
Entry
B479_03890        CDS       T02389                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B479_03890
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B479_03890
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    B479_03890
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     B479_03890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888267..889385
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTSRPSAMNELQAAASIGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGLEVARGLANYSALEAQKIIGQPSDAIESLLGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgtgaagattggcagtgctctgctg
accgccgatggcaaaggcctcgatcgcggtgccatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcaggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggctggacgtcgcgaccgagtgcgatgaacgagttgcaggcggcagcc
tcgatcggccagatgcgcctggtgcaggcctgggagtcgagcttcggcgagcacggcaag
cacaccgcgcaaatcctgctgacccatgacgacctgtccgaccgcaagcgctacctgaac
gcccgcagcaccctgcgcacgctggtcgacctgggcgtggtgccggtgatcaacgaaaac
gataccgtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcgctggtg
gccaacctggtcgaggctgacctgctggtgatcctcaccgaccgcgatggcatgttcgac
gccgacccgcgcaacaaccccgaagcccagctgatctacgaggctcgcgccgacgacccg
gcactggatgccgtggccggcggtaccggtggcgcgctgggtcgtggcggcatgcagacc
aagctgcgcgccgcgcgcctggctgcccgttccggtgcccacaccatcatcatcggtggt
cgcatcgagcgcgtgctggatcgcctcaaggctggcgaacgcctgggtaccttgctgtcg
cccgagcgcggcatgcttgccgcgcgcaagcagtggctggccggccatctgcagacccgt
ggcaccctggtgctggatgccggtgccgtgcaggcgctgcgccaggccaacaagagcctg
ctgccggttggcgtgaagaccgtgcagggcagcttccgtcgtggcgagatggtggtgtgc
gtcggcccggacggcctggaagtagcccgtgggctggccaactacagcgcccttgaggcg
cagaagatcatcggccagccatccgatgccatcgaaagcctgctgggctacagcgcagaa
ccggagttggtgcaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system