KEGG   Pseudomonas putida HB3267: B479_03890Help
Entry
B479_03890        CDS       T02389                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppuh01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppuh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
888267..889385
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTSRPSAMNELQAAASIGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGLEVARGLANYSALEAQKIIGQPSDAIESLLGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgtgaagattggcagtgctctgctg
accgccgatggcaaaggcctcgatcgcggtgccatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcaggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggctggacgtcgcgaccgagtgcgatgaacgagttgcaggcggcagcc
tcgatcggccagatgcgcctggtgcaggcctgggagtcgagcttcggcgagcacggcaag
cacaccgcgcaaatcctgctgacccatgacgacctgtccgaccgcaagcgctacctgaac
gcccgcagcaccctgcgcacgctggtcgacctgggcgtggtgccggtgatcaacgaaaac
gataccgtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcgctggtg
gccaacctggtcgaggctgacctgctggtgatcctcaccgaccgcgatggcatgttcgac
gccgacccgcgcaacaaccccgaagcccagctgatctacgaggctcgcgccgacgacccg
gcactggatgccgtggccggcggtaccggtggcgcgctgggtcgtggcggcatgcagacc
aagctgcgcgccgcgcgcctggctgcccgttccggtgcccacaccatcatcatcggtggt
cgcatcgagcgcgtgctggatcgcctcaaggctggcgaacgcctgggtaccttgctgtcg
cccgagcgcggcatgcttgccgcgcgcaagcagtggctggccggccatctgcagacccgt
ggcaccctggtgctggatgccggtgccgtgcaggcgctgcgccaggccaacaagagcctg
ctgccggttggcgtgaagaccgtgcagggcagcttccgtcgtggcgagatggtggtgtgc
gtcggcccggacggcctggaagtagcccgtgggctggccaactacagcgcccttgaggcg
cagaagatcatcggccagccatccgatgccatcgaaagcctgctgggctacagcgcagaa
ccggagttggtgcaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system