KEGG   Pseudomonas putida HB3267: B479_05190Help
Entry
B479_05190        CDS       T02389                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B479_05190
   00240 Pyrimidine metabolism
    B479_05190
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B479_05190
   03430 Mismatch repair
    B479_05190
   03440 Homologous recombination
    B479_05190
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     B479_05190
DNA replication proteins [BR:ppuh03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     B479_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1165252..1165683)
Genome map
AA seq 143 aa AA seqDB search
MSKVDFYILPTDSLSARLDFACKLCEKAWRLGHRVYLHCQDAEQRSELDQRLWRFKGEAF
VPHDLAEVHADASVALGLAADSAGDHHDLLINLGTGVPAFVGQFERVAEIVVEEPGIRQS
ARERFRFYREQGYALQDHRLQRL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcgatttctacatcctgcccaccgactcgctgtcggcgcggctcgatttc
gcctgcaagctgtgcgaaaaggcctggcgccttggccaccgggtctacctgcattgccag
gacgccgagcagcgcagcgagctggaccaacgcctgtggcgcttcaagggcgaggccttc
gtgccccacgacctcgcggaggtacatgccgatgccagcgtggcattgggcctggccgcc
gacagtgcgggcgaccaccacgacctgttgatcaacctgggcaccggcgtaccggccttc
gtcggccagttcgagcgagtggccgaaatcgtcgttgaagagcctggcatccgccaatcg
gcccgtgaacgattccgtttctaccgtgaacagggctatgctctgcaagaccaccgctta
cagcgactttga

DBGET integrated database retrieval system