KEGG   Pseudomonas putida HB3267: B479_05335Help
Entry
B479_05335        CDS       T02389                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00010  Glycolysis / Gluconeogenesis
ppuh00052  Galactose metabolism
ppuh00500  Starch and sucrose metabolism
ppuh00520  Amino sugar and nucleotide sugar metabolism
ppuh00521  Streptomycin biosynthesis
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01200  Carbon metabolism
Module
ppuh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B479_05335 (glk)
   00052 Galactose metabolism
    B479_05335 (glk)
   00500 Starch and sucrose metabolism
    B479_05335 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    B479_05335 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B479_05335 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B479_05335 (glk)
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B479_05335 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AGA71983
UniProt: L0FG48
Position
1199385..1200347
Genome map
AA seq 320 aa AA seqDB search
MKDLLVGDIGGTNARFALWRDNQLDEVKVFATEDYTSPEQAIEAYLEGLGIPRGGVTAAC
LAVAGPVDGDEFRFTNNHWRLSRVAFCQTLQVERLLLINDFTAMALGMTRLRPGEFREVC
PGQADLSRPALVIGPGTGLGVGALLRLGEQHWHALPGEGGHVDLPVGNAREAAIHQQIHG
QIGHVSAETVLSGGGLLRLYQAICSLDGDTPRHKTPAQITDAALGGEPRALAVIEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFVRSGFAASFSDKGCMSGYFAGVPVWLVT
AEFSGLLGAGVALQQALDNR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacctgctggttggcgacatcggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctggatgaagtgaaggtctttgccaccgaggactacaccagcccggaacag
gccatcgaggcttaccttgaaggcttgggcattccccgcggcggcgtgactgctgcctgc
ctggcggtggccggtccggtcgatggcgatgagttccgcttcaccaacaaccactggcgc
ctcagccgcgtggccttctgccagacattgcaggtcgagcggctgctgctgatcaacgat
tttaccgccatggcgctgggcatgacccgcctgcgccccggcgagttccgcgaagtgtgc
ccaggccaggcggacctgtctcggccggcattggtcattggcccgggtaccgggctgggc
gttggcgcgctattgcgcctgggcgaacagcactggcatgccttgccgggagagggcggg
cacgtcgacctgccggtgggcaatgcccgcgaagcggcgattcaccaacagattcacggg
cagatcggccatgtcagcgccgagaccgtgctcagtggcggtggcctgctgcgcctgtac
caggcaatttgctcgctggacggcgacacaccccgacacaagaccccggcacagatcacc
gatgccgcgctcggcggcgagccgcgggcgctggcggtgatcgagcagttctgccggttc
ctcggccgagtcgctggtaacaatgttctgacgctgggcgcacggggtggggtctatatt
gtcggcggcgtgatcccgcgctttgccgagctgttcgtgcgcagcgggtttgccgcgagt
ttttccgacaagggctgcatgagtggctatttcgctggtgtgccggtttggctggtgacg
gcggagttttccgggttgctgggggccggggtggctttgcagcaggcgctggataaccga
tag

DBGET integrated database retrieval system