KEGG   Pseudomonas putida HB3267: B479_05335Help
Entry
B479_05335        CDS       T02389                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B479_05335 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B479_05335 (glk)
   00052 Galactose metabolism
    B479_05335 (glk)
   00500 Starch and sucrose metabolism
    B479_05335 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    B479_05335 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B479_05335 (glk)
   00524 Butirosin and neomycin biosynthesis
    B479_05335 (glk)
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B479_05335 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199385..1200347
Genome map
AA seq 320 aa AA seqDB search
MKDLLVGDIGGTNARFALWRDNQLDEVKVFATEDYTSPEQAIEAYLEGLGIPRGGVTAAC
LAVAGPVDGDEFRFTNNHWRLSRVAFCQTLQVERLLLINDFTAMALGMTRLRPGEFREVC
PGQADLSRPALVIGPGTGLGVGALLRLGEQHWHALPGEGGHVDLPVGNAREAAIHQQIHG
QIGHVSAETVLSGGGLLRLYQAICSLDGDTPRHKTPAQITDAALGGEPRALAVIEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFVRSGFAASFSDKGCMSGYFAGVPVWLVT
AEFSGLLGAGVALQQALDNR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacctgctggttggcgacatcggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctggatgaagtgaaggtctttgccaccgaggactacaccagcccggaacag
gccatcgaggcttaccttgaaggcttgggcattccccgcggcggcgtgactgctgcctgc
ctggcggtggccggtccggtcgatggcgatgagttccgcttcaccaacaaccactggcgc
ctcagccgcgtggccttctgccagacattgcaggtcgagcggctgctgctgatcaacgat
tttaccgccatggcgctgggcatgacccgcctgcgccccggcgagttccgcgaagtgtgc
ccaggccaggcggacctgtctcggccggcattggtcattggcccgggtaccgggctgggc
gttggcgcgctattgcgcctgggcgaacagcactggcatgccttgccgggagagggcggg
cacgtcgacctgccggtgggcaatgcccgcgaagcggcgattcaccaacagattcacggg
cagatcggccatgtcagcgccgagaccgtgctcagtggcggtggcctgctgcgcctgtac
caggcaatttgctcgctggacggcgacacaccccgacacaagaccccggcacagatcacc
gatgccgcgctcggcggcgagccgcgggcgctggcggtgatcgagcagttctgccggttc
ctcggccgagtcgctggtaacaatgttctgacgctgggcgcacggggtggggtctatatt
gtcggcggcgtgatcccgcgctttgccgagctgttcgtgcgcagcgggtttgccgcgagt
ttttccgacaagggctgcatgagtggctatttcgctggtgtgccggtttggctggtgacg
gcggagttttccgggttgctgggggccggggtggctttgcagcaggcgctggataaccga
tag

DBGET integrated database retrieval system