KEGG   Pseudomonas putida HB3267: B479_05665Help
Entry
B479_05665        CDS       T02389                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppuh  Pseudomonas putida HB3267
Brite
Enzymes [BR:ppuh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     B479_05665
Secretion system [BR:ppuh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   B479_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275963..1276706
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAAAAATDSNAAAEQAIRKSLQNLELEVPVESVASSPVSGLYE
VKLQGGRVLYASGDGQFVMQGYLFQIQDGKPVNLTEKTERLGIAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSSGDQQLQAVWCS
SDRRAAMDKMVEGEEIKAAKCANPVSKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgct
gccgcggcaaccgatagcaatgctgctgccgagcaggccatccgtaagtcattgcagaac
ctcgagctggaagtgcccgtcgaaagcgtggccagcagcccggtcagtggcctgtatgaa
gtcaagctgcagggcggccgcgtgctgtatgccagcggcgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgagaagaccgagcgc
ctgggcattgccaagctcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtactgccac
aagctgcacgccgaggtgcccgagctcaaccgccgcggtatcgaagtgcgctatgtcgcc
ttcccgcgtcagggcctcggttcgtcgggtgaccagcagttgcaggccgtctggtgttcc
agcgaccgccgtgcggcgatggacaagatggtcgagggtgaggaaatcaaggccgccaag
tgcgccaacccggtcagcaagcagttccagctgggccagtcgatcggcgtcaacggcacg
ccggcgatcgtccttgaaagcggccaggtcattccgggctaccagccggcaccgcaggtc
gccaagctggcattggccaagtaa

DBGET integrated database retrieval system