KEGG   Pseudomonas putida HB3267: B479_07075Help
Entry
B479_07075        CDS       T02389                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00790  Folate biosynthesis
ppuh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B479_07075 (folE)
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     B479_07075 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int
Motif
Other DBs
NCBI-ProteinID: AGA72331
UniProt: L0FHV4
Position
complement(1582055..1582600)
Genome map
AA seq 181 aa AA seqDB search
MSLEQNYTEILSQIGEDVSREGLLDTPKRAAKAMKYLCRGYEQTLEEVTNNALFSSDNSE
MVLVRDIELYSMCEHHMLPFIGKAHVAYLPKGKVLGLSKVARIVDMYARRLQIQENLSRQ
VAEAVQQVTGAAGVAVVIEAKHMCMMMRGVEKQNSTMITSVMLGEFRENAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacagaactacaccgagatcctcagccagattggcgaggacgtctcccgt
gagggcctgctcgacacgcccaagcgggctgcaaaggcgatgaagtacctttgccgcggt
tatgagcaaacactggaagaagtcaccaacaacgcgctgttcagctctgacaacagcgaa
atggtgctggtccgggacatcgagctgtattcgatgtgcgaacaccacatgctgccgttc
atcggcaaggcgcacgtggcctacctgcccaagggcaaggtactgggcctgtcgaaggtg
gcgcgcatcgtcgacatgtacgctcgccgcctgcagatccaggaaaacctcagccgccag
gttgccgaggccgtgcagcaggtaaccggtgccgccggcgttgccgtggtcatcgaagcc
aagcacatgtgcatgatgatgcgcggtgtcgagaagcagaactcgaccatgatcacctcg
gtgatgctgggtgagttccgcgaaaacgccgccacccgcagcgagttcctcagcctgatc
aagtga

DBGET integrated database retrieval system