KEGG   Pseudomonas putida HB3267: B479_08300Help
Entry
B479_08300        CDS       T02389                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B479_08300 (fadB)
   01212 Fatty acid metabolism
    B479_08300 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B479_08300 (fadB)
   00650 Butanoate metabolism
    B479_08300 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    B479_08300 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    B479_08300 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B479_08300 (fadB)
   00310 Lysine degradation
    B479_08300 (fadB)
   00380 Tryptophan metabolism
    B479_08300 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B479_08300 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B479_08300 (fadB)
   00281 Geraniol degradation
    B479_08300 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B479_08300 (fadB)
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B479_08300 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B479_08300 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     B479_08300 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     B479_08300 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1860848..1862995
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIQADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLMAGALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEAQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVADATVLDVLKPIVYEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgcctgaccctgaacgaactg
cgccaggccgtcgatgccatccaggccgacgcctcggtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatagtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cccgaggccgaactggtcgccggcaacctggaagccaaccgcattttcaacgccttcgaa
gacctcgaagtgccgaccgtcgccgccatcaacggcatcgccctgggcggcggcctggaa
atgtgcctggccgccgactaccgggtcatgtccaccagcgccaagatcggcctgccggaa
gtcaagctgggtatctacccgggctttggcggcaccgtgcgcctgccgcgcctgatcggt
tcggacaacgccatcgaatggatcgccgccggcaaggaaaaccgtgccgaggacgccctg
aaagtgggggctgtcgacgccgtggtcgcgcctgagctgctgatggccggtgcccttgac
ctggtcaagcgcgccatcagtggcgagctggactacaaggccaagcgccagcccaagctg
gaaaagctcaagctcaacgccatcgaacagatgatggccttcgagactgccaagggcttc
gtcgccggccaggccggcccgaactacccagccccggtcgaagccatcaagactatccag
aaggctgccaacttcggccgtgacaaggccctggaagtcgaagccgcaggcttcgccaag
ctggccaagacctcggttgccgagagcctcatcggcctgttcctcaacgaccaggaactc
aagcgcaaggccaaggcgcatgacgaaatcgcccacgacgtgaagcaggccgccgtgctc
ggtgccggcatcatgggtggcggcatcgcctaccaatcggcggtcaagggcaccccgatc
ctgatgaaggatatccgcgaggaagccatccagctgggcctgaacgaggcctccaagctg
ctcggcaaccgcgtcgagaagggccgcctgaccccggccaagatggccgaggcactcaac
gccattcgcccgaccctgtcctatggtgacttcgccaatgtcgacatcgtcgtcgaggcc
gtggtcgagaacccgaaagtcaagcaggccgtgctggctgaagtggaagcccaggtgaag
gacgatgcgatcctcgcttccaacacctcgaccatttccatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgttggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtcatccgtggcgagaagtccagtgaagtggcggttgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggcttcctggtc
aaccgcgtgctgttcccgtacttcggcggcttcgccaagctggtaagcgccggtgtcgac
ttcgtgcgtatcgacaaggtcatggagaagttcggctggccaatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggccgcgacgtgatggccgaagggttc
ccggaccgcatgaaggacgagcgccgctcggccgttgacgcattgtacgaggccaaccgc
ctggggcagaagaacggcaagggcttctacgcctacgaaaccgacaagcgcggcaagccg
aagaaggtcgccgacgccaccgtgctcgacgtgctcaagccgatcgtctacgagcagcgt
gaagtcaccgacgaagacatcatcaactggatgatggtcccgctgtgcctggagaccgtg
cgctgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggtctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgctacatcgactcgatcggtgtg
gccgaattcgttgccctggccgatcaatacgccgacctggggccgctgtaccacccgacc
gcgaagctgcgtgagatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system