KEGG   Pseudomonas putida HB3267: B479_08345Help
Entry
B479_08345        CDS       T02389                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B479_08345
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    B479_08345
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     B479_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1870952..1871962
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRHLLRQPEVAGLIIFARNIDSPRQVRELCASIRAIRPD
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFESDPLRATQLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQADLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIAGMRGQGFARTDYRQQPRWQQALSALKDAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcacctgctacgccaacctgaagtggctggcctgatcatttttgcccgcaac
atcgacagcccgcgccaggtgcgtgaactgtgcgcgtcgatccgtgccatccggcccgac
ctgatcctggcggtggaccaggagggcggccgggtgcagcgcctgcgccagggctttgtg
cgcctgccggccatgcgagcgctggccgacaatgacaacgccgagtacctggccgagcag
tgcggttggttgatggcgaccgaggtgctggcggttggcctggacctcagctttgccccg
gtactcgacctggaccaccagcgcagcgccgtggtgggcagccgcgccttcgagagtgac
ccgctgcgtgccacgcaactggccggggcgttcatccgtggcatgaatgcggcgggtatg
gcggcttgtggcaagcacttcccggggcatggctgggccgaagcggactcgcatgtggcc
atcccgaccgatgagcgcagcctcgaacagctgcgccaggccgacctggtgccgttcacc
cgcctgagcgggcaattggcggcagtgatgccggcgcatgtcatctacccgcaggtcgac
aaccagccggctggcttctcacggcgctggttgcaggacatcctgcgtggcgagctgggt
ttcgacggggtgattttcagtgacgatttgtcgatggccggcgcacatgttgtcggggac
gcggcgagccgcatcgaagcagcactgagcgccggttgtgatatggggctggtttgcaat
gatcgggcggcggcggagctggcattgagcgcggcacaacgcatgaaggtaaaaccttcg
ccacgcatcgcaggcatgcgcgggcaagggtttgcgcggactgactatcgtcagcagcct
cgttggcagcaggcattgtccgcgttgaaggacgctcaactggtcgactga

DBGET integrated database retrieval system