KEGG   Pseudomonas putida HB3267: B479_08925Help
Entry
B479_08925        CDS       T02389                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    B479_08925
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     B479_08925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1982338..1983303
Genome map
AA seq 321 aa AA seqDB search
MEQAVNNDQAMTRDSLYGTAAESTYAGITSFSRRRYSRDLRGVDVVVSGVPFDTATSNRP
GARFGPRAIRAASVQQAWARHWPWAFDPFDHLAVIDYGDCAFDSGTPQSVPDSIEAHATH
ILEAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEEGKRIDHGTMFWH
AAREGLVDPASSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTF
DIDCLDPAYAPGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAG
ATLAMEMLCLYAARHKVDKGQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggagcaagccgtaaacaacgaccaggccatgacccgcgacagcctgtatggcaccgct
gcggaaagtacctacgccggtattaccagtttctctcgccgccgctacagccgcgacctg
cgtggtgtcgatgtggtggtcagtggtgtgccgttcgatactgccaccagcaaccgcccc
ggtgcgcgcttcggcccgcgggcgatccgcgccgcctcggtgcagcaggcctgggcccgg
cactggccatgggcgttcgacccgttcgaccacctggcggtgatcgactatggcgattgc
gccttcgacagcggcaccccgcagtcggtaccggacagcatcgaggcccatgccacgcat
attctggaagcaggctgcgccatgctcaccctgggtggcgaccacttcatcagctacccg
ctgctcaaggcccatgcccgtcgccatggcccgctggcgctgatccacttcgatgcgcac
agcgacacctggccggacgaggaaggcaagcgcatcgaccacggcaccatgttctggcat
gccgcccgcgaaggcctggtggacccggccagctcggtgcagatcggcctgcgcaccacc
aatgacgacagccagggctttgccatcctcgacgcccgccaggtgcaccggcagggcacc
gaggcggtgatcgcggcgattcgccagcgggtgggcgagcggccggtttacctgaccttc
gatatcgactgcctcgacccggcgtatgcgcccggtaccggcacgccggtgtgcggtggg
ctgagcacggtgcaggcgctggagatccttggcgggctgcgcggcatcaacctggtgggc
atggacctggtggaggtggcgccagcctatgaccatgccgacatcaccgcgctggccggg
gcgaccctggcgatggaaatgctgtgcctgtatgcggcgcggcacaaggtggacaagggc
cagtaa

DBGET integrated database retrieval system