KEGG   Pseudomonas putida HB3267: B479_09410Help
Entry
B479_09410        CDS       T02389                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    B479_09410
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     B479_09410
   3.1.2  Thioester hydrolases
    3.1.2.-  
     B479_09410
Lipid biosynthesis proteins [BR:ppuh01004]
 Fatty acid synthase
  Component type
   B479_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2093538..2094143
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDTRQGWVSLLQTRLRDEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIESSRK
AGAKVVLLGMRLPPNYGVRYTTAFAQVYEQLATEKQVPLVPFFLEGVGGVPELMQADGIH
PAQAAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcggcg
gcgggaacactgctggttgtcggcgatagtatcagcgccggttttggcctggatacccgc
cagggctgggtttccctgttgcagacccgcctgcgggacgaaggtttcgacgacaaggtg
gtcaatgcatcgatcagcggcgacaccagtgcaggtggccaggcgcggctgccggcgctg
cttgcagcgcacaagccgagcctggtggtactggaactgggcggcaacgatggcctgcgt
gggcagccgccagcgcaattgcaacaaaatcttgcctcgatgatcgagagctcgcgcaag
gccggtgccaaggtggtgctgctgggcatgcgcctgccacccaattatggcgtgcgctac
accaccgccttcgcccaggtgtatgagcagctggcgacggaaaaacaggtgccgctggtg
ccgtttttcctcgagggggtagggggcgtgcctgagttgatgcaggcggatggcattcac
ccggcccaggccgcccagcagcgcctgctggaaaatgcctggccggcgataaaacccttg
ctgtga

DBGET integrated database retrieval system