KEGG   Pseudomonas putida HB3267: B479_10000Help
Entry
B479_10000        CDS       T02389                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B479_10000
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B479_10000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2223002..2223910
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVARAQRLPRAGETLPGESFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCQGVSSGVALITVDAASQNCIVIVPGGNGLLTP
QSVQRFDALLQAAEVIICQLEVPADTVAWTLARGHELGKRVILNPAPATGPLPADWFARI
DYLTPNESEAEALTGVAVTDLDSARRAGECLLKLGAGKVIITLGAQGALLVTPRGHQHFP
APVVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
AP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtagtcggtagcctcaacatggacctggtggcccgcgcgcag
cgcctgccccgggccggcgaaacacttcccggcgaaagctttttcaccgtgccgggcggc
aagggggccaaccaggcagtggccgtggcgcgcctgggtggcagcgtggcgatgatcggc
aacgttggcgacgatgactatggtcgacaactgcaccgggccctgtatgtggaaggcatc
gactgccagggcgtcagcacctgccagggcgtgtccagcggggtggcgctgatcaccgtg
gatgccgccagccagaactgcatcgtcatcgtccccggtggcaacggcctgctgacgccg
cagtcggtgcagcggttcgatgcgctgctgcaggcggccgaggtgatcatctgccagttg
gaagtaccggccgacaccgtggcctggaccttggcccgggggcatgaactgggcaagcgg
gtgatcctgaacccggcgccggcgaccggccccttgccggcggactggttcgcccgcatc
gactacctgacgcccaacgaaagcgaggccgaagccctgaccggcgtggcggtgactgac
ctggacagcgcccgacgtgccggcgaatgcttgctgaaactgggcgcgggcaaagtgatc
atcaccctgggcgcgcaaggggctttgctggtcacccctcggggccaccagcacttcccc
gcgccggtggtgcagccgctggacaccacggcagccggcgacaccttcatcggcggcttt
gccgcaggcctggtgcgcggcctggaggagggcgaagccatcgccttcggccagcgcgcc
gcggccctgtcagttacccgcgccggtgcccagccgtcgattccctacctggcggagctt
gcgccatga

DBGET integrated database retrieval system