KEGG   Pseudomonas putida HB3267: B479_12520Help
Entry
B479_12520        CDS       T02389                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppuh  Pseudomonas putida HB3267
Brite
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     B479_12520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2739807..2740733
Genome map
AA seq 308 aa AA seqDB search
MLVVLPAWVLAQSIGGPLTPLPAVPELDPARVELGRKLFNDSRLSLDNSQSCADCHRLDR
GGADGQARSPGADGKPLPVHTPSVFNASLNFLQFWDGRAQSFDGLVHLATGNTDGKEDGW
ATVVQRIADDPAYQTGFAEAYGKPVTAIDVKDALVTYQRTLLTPDSRFDRYLKGDTSSLS
LEEKHGYQRFQEYGCIACHQGVNIGGNMLQKFGVFDDYFTNRGSVTLADQGLYNVTGDPD
DLHLFKVPSLRNVEVTAPYFHDGSAPTLEAAVDAMFHYQLGRTPSDDDKALIIKFLQTLT
GQWEGKPL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtggttttgccggcatgggtgctggcccagagcattggtgggccgctcacgcca
ttgccggcggtgcctgagcttgaccctgcccgggtggaactggggcgcaaactgttcaat
gactcgcgattgtccctcgataacagccagtcctgtgctgattgccatcgcctggatcgt
ggtggcgcggacgggcaggcgcgctcgcctggtgcagatggcaaacccttgccagttcac
acacccagcgtcttcaacgccagcctgaacttcctgcagttctgggatgggcgcgcgcaa
tcgtttgacggcctggtgcacctggcaaccggtaatacggacggcaaagaagatggctgg
gctaccgtggtccaacgaattgctgacgatccggcttaccagacggggttcgccgaagcc
tatggcaaaccagtgaccgccatcgatgtcaaagatgccctggttacgtaccagcgtacc
ctgctgacacccgattcacgcttcgatcgctatctgaaaggagataccagcagcctcagc
ctggaagagaagcatggctatcagcgcttccaggagtacggttgtatagcctgccaccag
ggtgtgaatatcggcggcaacatgctgcagaagttcggtgttttcgatgattatttcacc
aaccgtggcagtgttaccttggcagatcaggggctctacaacgtgacaggtgatccggac
gatctccacctgttcaaagttccaagcctgcgaaacgtggaggtgactgccccttacttt
catgatggttcggcgcccaccttggaagcagccgtcgatgccatgtttcattatcagttg
ggacgtacgccgagcgacgatgataaagcgctgatcatcaagtttctccagaccctcacc
ggccaatgggagggtaaaccgctatga

DBGET integrated database retrieval system