KEGG   Pseudomonas putida HB3267: B479_15685Help
Entry
B479_15685        CDS       T02389                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B479_15685
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     B479_15685
    3.5.1.-  
     B479_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3475398..3476048
Genome map
AA seq 216 aa AA seqDB search
MKIASFDVDAQNGFTSNVPQELPVPEGHEIAVDLNTMALRADLRLGSKDAHPANAAWVVA
DPAHMLQPLQLANADLTWVSHCVPGTPGFELLPGLPAPIDYDYFVWKGVEPDLHPYGACY
HDLAERRSTGVIEYLKVQQVGAVIVGGLALDYCVRTTARQLRQAGFQVLLYLPACRALTQ
AGAIEACGALAAEGVILCGDEAALDHQLSLIKEDRP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccagtttcgatgtcgacgcccagaacggcttcaccagcaacgtgccgcaa
gagctgccggttcccgaaggccatgaaatcgcggtagatcttaataccatggccttgcgc
gccgacctgcgcctgggcagcaaggacgcccacccggccaacgccgcctgggtagtcgcc
gaccccgcgcacatgctgcagcccctgcagctggccaacgccgacctgacctgggtcagc
cactgcgtgcccggcacacccggcttcgagttgctgcccggcctgccggcccccatcgac
tatgactatttcgtatggaaaggcgtcgagcccgacctgcacccctacggcgcctgctac
cacgacctggccgaacgccgctccaccggggtgatcgagtacctcaaggtgcagcaggtg
ggcgcggtgatcgtcggtggcctggccctggactattgcgtcaggaccactgcgcgccaa
ttgcgccaggccggtttccaggtgctgttgtacctgccggcctgccgcgccctcacccag
gcaggcgccatcgaagcatgtggcgccttggccgccgagggcgtgatcctctgcggcgac
gaagccgcgctcgaccaccagctctctctgatcaaggaagaccgcccatga

DBGET integrated database retrieval system