KEGG   Pseudomonas putida HB3267: B479_15995Help
Entry
B479_15995        CDS       T02389                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B479_15995
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B479_15995
   00630 Glyoxylate and dicarboxylate metabolism
    B479_15995
Enzymes [BR:ppuh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B479_15995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3548121..3550292
Genome map
AA seq 723 aa AA seqDB search
MPNHPLQIAPTLQRFIEDEVLPGTGIEARTFWQGFSTLIHDLAPQNRALLAEREHLQTEL
DNWHRQHPGPIRDMAAYQHFLQGIGYLVEPPASVQVSTRNVDREIAVQAGPQLVVPLSNA
RYALNAANARWGSLYDALYGTDAIAETEGTERGQGYNPQRGAKVIAYGRQFLDTAAPLDG
ASHNDAKAYAISQGTLQVTLADGRQVGLRHPAQLRGYQGEPNTPTAILLQHHQLHFEIQV
DPANAIGRQDPAGVKDILLEAALTTIIDCEDSVAAVDADDKVNVYRNWLGLMKGDLSEQV
SKGGKTFERTLAKDRHYHGADDQPLTLPGRSLLFIRNVGHLMTNPAIHDRDGREIPEGIL
DAVVTSLIGLHDLKRRGNSREGSLYIVKPKMHGPAEVAFADQLFGRVEALLGLPAHTLKM
GIMDEERRTSVNLKACIASAASRVVFINTGFLDRTGDEMHTAMEAGAMLRKGDMKGSAWI
QAYERSNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKVAQPRAGANTAWVPSPTAAT
LHALHYHQVDVAAVQQTLEQVDLNAQRAELLHDLLSVPVSPERPWSAAEIQAELDNNCQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISAQHIANWLHHGVVDAEQVEATLQR
MAGVVDQQNAGDPAYRPMAAGFEASHAFRAARELVFKGRQQPSGYTEPLLHGWRLLFKQE
VGR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccatccactccagatcgcccccaccctgcagcgcttcatcgaagatgaggtc
ctccccggcaccggcatcgaagcccgcaccttctggcaaggcttcagcaccctgatccac
gacctcgcaccacaaaaccgcgccctgctcgccgaacgcgagcacctgcagacagaactc
gacaactggcaccgccagcaccccggcccgatccgtgacatggccgcctaccagcatttc
ctgcaaggcatcggctaccttgtagagcccccggcaagcgtgcaggtcagcacccgcaac
gtcgaccgcgagatcgccgtgcaggccggcccgcaactggtagtgccactgagcaacgcc
cgctacgccctcaacgccgccaacgcccgctggggctcgctgtacgatgccctgtacggc
accgatgccatcgccgaaaccgagggcaccgaacgtggccagggctacaacccgcaacgc
ggcgccaaggtgatcgcctatggccggcagttcctcgacaccgcggcccccctcgacggt
gcgtcgcacaacgacgccaaggcctacgcgatcagccagggcacgctgcaggtaaccctg
gccgatggccgccaggtcggcctcaggcaccccgcgcaactgcgtggttaccaaggtgag
ccgaacacgccaacagcgatcctgttgcagcatcaccagctgcatttcgaaatccaggtc
gacccggccaacgccatcggccggcaggacccggccggggtcaaggacatcctgctggag
gccgcgctcaccaccatcatcgactgcgaagactcggtagccgccgtggatgccgacgac
aaggtcaacgtctaccgcaactggctcggcctgatgaagggcgacctcagcgaacaggtc
agcaagggcggcaagaccttcgaacgcaccctggccaaagaccgccactaccacggcgca
gacgaccagccactgaccctgccaggccgctcgctgctgttcatccgcaacgtcggccac
ctgatgaccaacccggccatccacgaccgcgatggccgggaaatcccggaaggcatcctc
gatgctgtggtcaccagcctgatcggcctgcatgacctcaagcgccgtggcaattcccgc
gagggcagcctgtacatcgtcaagccgaagatgcacgggccggccgaggtggcctttgcc
gaccagctgttcggccgtgtcgaagccctgttgggcctgcccgcacacacgctgaagatg
ggcatcatggacgaggagcggcgtaccagcgtcaacctcaaagcctgcatcgccagcgcc
gcgtcacgggtggtgttcatcaataccggcttcctcgaccgcaccggtgacgagatgcac
acggccatggaagccggcgccatgctgcgcaagggcgacatgaaaggcagtgcctggatc
caggcctacgagcgcagcaacgtactggtggggctggcctgtggcctgcgcggcaaggcg
caaatcggcaagggcatgtgggccatgcccgacctgatggcggccatgctggaacagaaa
gtcgcccagcccagggccggcgccaacacggcctgggtgccctcgcccacagccgcgaca
ctgcatgcgctgcactaccaccaggtggatgtggcggccgtgcagcaaacgctggaacag
gttgacctgaatgcccagcgcgccgagttgctgcatgacttgctcagtgtcccggtcagc
cccgagcggccctggagcgcagccgaaatccaggccgagctggacaacaactgccagggt
atcctcggttacgtggtgcgctgggtcgagcaaggggtaggctgttccaaggtgccggat
atccatgatgtgggcttgatggaagaccgcgcgaccctgcggatttccgcgcagcacatt
gccaactggctgcaccacggggtggtcgatgccgagcaggtcgaggcgaccttgcaacgc
atggccggcgtggtcgaccagcagaatgccggggacccggcgtaccggccgatggccgcc
ggtttcgaggcatcgcatgccttccgcgctgcgagggagctggtgttcaaggggcggcag
cagcccagtggctataccgaaccgttactgcatggctggcgcttgcttttcaagcaggag
gttgggcgctga

DBGET integrated database retrieval system