KEGG   Pseudomonas putida HB3267: B479_16445Help
Entry
B479_16445        CDS       T02389                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B479_16445
   00052 Galactose metabolism
    B479_16445
   00500 Starch and sucrose metabolism
    B479_16445
   00520 Amino sugar and nucleotide sugar metabolism
    B479_16445
Enzymes [BR:ppuh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B479_16445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3632182..3633021)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYNQFRCSIVAIQEVDPQETNKYGVIAGDMIRD
DIFRVTNMVEKPKPEDAPSNLAIIGRYILTPDIFDIIANTEPGKGGEIQITDALMQQAQN
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcttgttcccggcagccggttacggcacccgcttcctgcccgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaggcactggatgccggtctgaacgagatctccatcgtcaccgggcgcggcaagcgt
gctttggaagaccacttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggttggtatccgtcgcctgctcgacgagtgctcgttctcctacacc
cgccagaccgaaatgaaaggcctgggccacgccatcctgactggccgcccgctgatcggc
gacgagccgttcgccgtggtgctggcggacgacctgtgcgtgaacccggaaggtgacggc
gtactgacccagatggtcaagctgtacaaccagttccgttgctcgatcgtcgccatccag
gaagtcgatccgcaggaaaccaacaagtacggcgtgatcgccggcgacatgatccgtgac
gacattttccgtgtcaccaacatggtcgagaagccaaagccggaagacgccccgtcgaac
ctggcgatcattggtcgctacatcctgaccccggacatcttcgacatcatcgccaacacc
gagccgggcaaaggtggcgagatccagatcaccgacgccctgatgcaacaggcgcagaac
ggctgcgtgatcgcctacaagttcaaaggcaagcgtttcgactgcggtggcgccgagggt
tacatcgacgcgaccaacttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system