KEGG   Pseudomonas putida HB3267: B479_16535Help
Entry
B479_16535        CDS       T02389                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B479_16535
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B479_16535
  Lipid metabolism
   00071 Fatty acid degradation
    B479_16535
  Amino acid metabolism
   00350 Tyrosine metabolism
    B479_16535
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B479_16535
   00626 Naphthalene degradation
    B479_16535
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B479_16535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3645977..3646987
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVEVVEKTLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQAVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCREVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVINSRAEDAAKVIQAKTGGAHAAVVTAVAKA
AFNSAVDALRAGGRLVAVGLPSEAMNLNIPRLVLDGIEVIGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgttgcaccaggccgtcgcgtggaagtggtggagaaaaccctgcgc
cccctcgagcacggtgaagcgctgctgaagatgcaatgctgcggtgtgtgccacaccgac
ctgcatgtgaaaaatggcgacttcggtgacaagaccggtgtggtgctaggtcacgaaggc
atcggcgtggtccaggcagtagggccaggcgtcacctcgctcaaaccgggcgaccgcgcc
agcgtggcctggttctaccagggctgcgggcattgcgagtattgcaacagcggcaacgaa
accctgtgccgcgaagtgaagaactccggctacaccgtggacggcggcatggccgaagcc
tgcatcgtcaaggccgactactcggtcaaagtgcccgacgggctcgactccgctgccgcc
agcagtattacctgcgccggcgtcaccacctacaaggcggtgaagatctccaacatccgc
cccggccaatggatcgccatctacggcctcggcggcctgggcaaccttgccctgcaatat
gccaagaacgtcttcaacgccaaagtgatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgctgacctggtcatcaactcacgcgccgaagatgccgccaag
gtcatccaggccaagaccggtggcgcccatgccgccgtggttaccgccgttgccaaggct
gccttcaactcggccgttgacgccctgcgtgcgggtggccgcctggttgcggtcggcctg
ccgtcggaagccatgaacctgaacatccctcgcctggtgctggacggtatcgaagtgatc
ggctcgctggtcggtacccgccaggacctgcaggaagctttccagtttgcggcggaaggg
aaagtggtgccgaaggtgactctgcgaccgatcgaggatatcaaccagatcttcgatgag
atgctggagggcaagatcaaagggcggatggtgattcagttcgaggggtga

DBGET integrated database retrieval system