KEGG   Pseudomonas putida HB3267: B479_16535Help
Entry
B479_16535        CDS       T02389                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00010  Glycolysis / Gluconeogenesis
ppuh00071  Fatty acid degradation
ppuh00350  Tyrosine metabolism
ppuh00625  Chloroalkane and chloroalkene degradation
ppuh00626  Naphthalene degradation
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B479_16535
  Lipid metabolism
   00071 Fatty acid degradation
    B479_16535
  Amino acid metabolism
   00350 Tyrosine metabolism
    B479_16535
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B479_16535
   00626 Naphthalene degradation
    B479_16535
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     B479_16535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TrkA_N Methyltransf_25 CoA_binding 2-Hacid_dh_C Methyltransf_31 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AGA74199
UniProt: L0FJR1
Position
3645977..3646987
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVEVVEKTLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQAVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCREVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVINSRAEDAAKVIQAKTGGAHAAVVTAVAKA
AFNSAVDALRAGGRLVAVGLPSEAMNLNIPRLVLDGIEVIGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgttgcaccaggccgtcgcgtggaagtggtggagaaaaccctgcgc
cccctcgagcacggtgaagcgctgctgaagatgcaatgctgcggtgtgtgccacaccgac
ctgcatgtgaaaaatggcgacttcggtgacaagaccggtgtggtgctaggtcacgaaggc
atcggcgtggtccaggcagtagggccaggcgtcacctcgctcaaaccgggcgaccgcgcc
agcgtggcctggttctaccagggctgcgggcattgcgagtattgcaacagcggcaacgaa
accctgtgccgcgaagtgaagaactccggctacaccgtggacggcggcatggccgaagcc
tgcatcgtcaaggccgactactcggtcaaagtgcccgacgggctcgactccgctgccgcc
agcagtattacctgcgccggcgtcaccacctacaaggcggtgaagatctccaacatccgc
cccggccaatggatcgccatctacggcctcggcggcctgggcaaccttgccctgcaatat
gccaagaacgtcttcaacgccaaagtgatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgctgacctggtcatcaactcacgcgccgaagatgccgccaag
gtcatccaggccaagaccggtggcgcccatgccgccgtggttaccgccgttgccaaggct
gccttcaactcggccgttgacgccctgcgtgcgggtggccgcctggttgcggtcggcctg
ccgtcggaagccatgaacctgaacatccctcgcctggtgctggacggtatcgaagtgatc
ggctcgctggtcggtacccgccaggacctgcaggaagctttccagtttgcggcggaaggg
aaagtggtgccgaaggtgactctgcgaccgatcgaggatatcaaccagatcttcgatgag
atgctggagggcaagatcaaagggcggatggtgattcagttcgaggggtga

DBGET integrated database retrieval system