KEGG   Pseudomonas putida HB3267: B479_17090Help
Entry
B479_17090        CDS       T02389                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00071  Fatty acid degradation
ppuh00280  Valine, leucine and isoleucine degradation
ppuh00281  Geraniol degradation
ppuh00310  Lysine degradation
ppuh00360  Phenylalanine metabolism
ppuh00362  Benzoate degradation
ppuh00380  Tryptophan metabolism
ppuh00410  beta-Alanine metabolism
ppuh00627  Aminobenzoate degradation
ppuh00640  Propanoate metabolism
ppuh00650  Butanoate metabolism
ppuh00903  Limonene and pinene degradation
ppuh00930  Caprolactam degradation
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01212  Fatty acid metabolism
Module
ppuh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B479_17090
   00650 Butanoate metabolism
    B479_17090
  Lipid metabolism
   00071 Fatty acid degradation
    B479_17090
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B479_17090
   00310 Lysine degradation
    B479_17090
   00360 Phenylalanine metabolism
    B479_17090
   00380 Tryptophan metabolism
    B479_17090
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B479_17090
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B479_17090
   00281 Geraniol degradation
    B479_17090
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B479_17090
   00627 Aminobenzoate degradation
    B479_17090
   00930 Caprolactam degradation
    B479_17090
Enzymes [BR:ppuh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B479_17090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGA74310
UniProt: L0FNS5
Position
complement(3743962..3744774)
Genome map
AA seq 270 aa AA seqDB search
MTEYSAFKVELTNSIAHVQINRPDKRNAMNAAFWEEIIDIFQWVDDTDAVRAVVISGAGK
HFSAGIDLMMLASLAGQMGKDVGRNARFLRSTILRLQASFNAVDKCRKPVLAAVQGYCIG
GAIDLISACDMRYCSSDAQFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAYTGRNVEA
EEALRIGLVNRVYDDQAALMDGVFAIAGEIAAKSPIAVAGTKEMLSYMRDHRIDDGLEYI
ATWNAAMLQSEDLRVAVAAHMSKQKPTFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagtacagcgcattcaaggtcgaactgaccaacagcatcgcccacgttcagatc
aaccgcccggacaagcgcaatgcgatgaacgctgccttctgggaggagatcatcgacatc
ttccagtgggtcgacgacaccgatgcagtgcgagcggtagtgatcagcggtgccggcaag
catttttccgccggtatcgacctgatgatgctggcttcgctggccgggcagatgggcaag
gacgtgggtcgtaacgcgcgcttcctgcgcagtaccatcctgcgcctgcaggcgtcgttc
aatgccgtggacaaatgccgcaagccggtactggccgcggtgcagggttactgcattggc
ggcgccatcgacctcatctcggcttgcgacatgcgctactgcagcagcgacgcgcagttc
tcgatcaaggaaatcgacatgggcatggccgccgatgtcggcacactgcaacgtttgcct
cgtatcatcggtgacggcatgatgcgtgagctggcttacacggggcgcaatgtcgaggca
gaagaggcgctgcgcatcggcttggtcaaccgggtttatgatgatcaggctgcgctgatg
gacggggtctttgccatcgctggcgagattgccgcaaaatcgccgatcgccgtggccggc
accaaggaaatgctcagctacatgcgtgaccatcgcatcgatgatggcctggagtacatc
gccacctggaacgccgcgatgctgcagtccgaagacctgcgcgtggcggtggcggcgcac
atgagcaaacagaaaccgacgttcgccgactga

DBGET integrated database retrieval system