KEGG   Pseudomonas putida HB3267: B479_17185Help
Entry
B479_17185        CDS       T02389                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B479_17185
Enzymes [BR:ppuh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     B479_17185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3767329..3769398
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLASRVGLSRDWIDANARPQRVSDEVLRNILEGLGHPANDDAAIAASLRAVDA
AEDSEHLPPLLTADLGQPLALARYFSAASVAHCTLEDHSALTLSLDDQARLPGALPIGYH
QVEIDSRRFTVAVAPLRCHSLEDRVQQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RAAAERGADALAISPIHALLAIDQTHYSPYSPSSRLLLNTLYASPAALLGEREVRVAIEA
CGLEQQLEDLEQGPLVDWPRAASARQRLLEALYQGFSQGDHPLRKDFDSFRKAGGQALEH
HCRFEVLQAQAVEHGLGADWRHWPKAWHDPYHPEVEAFTNAYPAKVEFHAFCQWLTERGL
QRAQEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPL
EDLLRLLALESVRHQAIILGEDLGTVPDGLREQLAAKAVLGMRVLPFEQTQPGHFKPILD
WPDNALATTGTHDLAPLAGWLENRDIDWNHRLQLIDAATELHWRHERQKEHDGLRRTLEA
NYGTLPNNDALIDAAIRYVGHTRAPLVLVPLEDLLGCDEQPNLPGTTAGHPNWRRRFARP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcgagccgcgtcgggctgagccgcgactggatc
gacgccaatgcccggccccagcgtgtcagcgacgaggtactgcgcaacatacttgaaggt
cttggccaccctgccaacgatgacgccgccatcgccgccagcctgcgcgccgtggacgct
gccgaagacagtgagcacctgccgccgctgctgaccgccgacctaggccagccattggca
ctggcgcgctacttcagcgccgccagcgttgcgcactgcacactggaggaccacagcgcc
ctcaccctcagccttgacgaccaggcccgcctgcccggtgcgctgcccatcggctaccac
caggtggaaatcgacagccgccgcttcaccgtggccgtggccccgctgcgctgccacagc
cttgaagaccgggtgcaacagccgccaccgcgctgctggggcctggcggtgcagctgtac
agcttgcgccgccccggcgatggcggctatggcgactgcctggccttggaacaactggcc
cgcgcggctgccgaacgcggcgccgatgccttggccatcagcccgatccacgccctgttg
gccatcgaccagacgcactacagcccctactcgccctccagccgcctgctgctcaatacc
ctgtacgccagcccagccgcgctgctgggcgagcgggaggtgcgcgtggccatcgaagcc
tgcggcctggagcaacagctcgaagaccttgagcaaggcccgctggtagactggccgcgt
gccgccagcgcccgacagcgcctgctcgaagccctgtaccagggcttcagccagggcgac
cacccgctacgcaaggacttcgacagcttccgcaaagccggtggccaggcgctggaacac
cattgccgcttcgaagtgctgcaggcgcaagccgtggagcatggcctgggcgccgactgg
cgccactggcccaaggcctggcacgacccataccacccggaagtggaggccttcaccaac
gcctacccggccaaggtcgagttccatgccttctgccaatggctgaccgaacggggcctg
caacgcgcccaggaagcagcgcgcggcaacggcatggcggtcggcctgatcgctgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggacgagctgctggca
ggcctgaaggtgggtgcaccgcctgacatcctcaaccgtgccggccaggactggggcatc
tgcgccttctcgcctgaagggctcaagcgcaacggctaccgcgctttcatcgaaatgctc
cgggccaacctcgcccacgccggcggcctgcgcatcgaccatgtcatgggcctgcgccgg
ctgtggctgatcccgcagggggccaagcccagcgaaggcgcctacctcaactacccgctg
gaagatctgttacgcctgctggccctggagtcggtgcgccaccaggcaatcatcctcggc
gaagacctgggcaccgtgccggacggcctgcgcgagcaactggcggccaaggccgtgctg
ggcatgcgcgtgctgcccttcgagcagacccagcccggccatttcaagccgattctcgac
tggccggataacgccctggccaccaccggcacccatgacctggcgccgctggccggctgg
ctggaaaaccgcgacatcgactggaaccaccgcctgcaactgatcgatgctgccaccgaa
ctgcactggcgccacgagcggcagaaggagcacgatggtttgcgccgcaccctggaggcc
aactacggcacgctgccgaacaacgacgcgctgatcgacgctgccatccgttacgttggc
cacacccgcgcaccgctggtgctggtgccgctggaagacctgctgggttgcgacgagcaa
cccaacctgccgggcaccaccgccggccaccccaactggcgccgacgctttgcccggccg
gtacgtgaactgctcgacgacgaagacgctgcgcggcgcctggaactgctggcccaggcc
cgcgaacaggcttgggagcgtgaccgatga

DBGET integrated database retrieval system