KEGG   Pseudomonas putida HB3267: B479_17440Help
Entry
B479_17440        CDS       T02389                                 

Definition
glutathione S-transferase domain-containing protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppuh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3831631..3832326)
Genome map
AA seq 231 aa AA seqDB search
MTDLSAFPITRKWPARHPERLQLYSLPTPNGVKVSIMLEEIGLAYEPHKVSFDNDDQLSP
EFISLSANNKIPAILDPNGPGGRPLPLFESGAILQYLAEKSGQLLSQDPAQRYQTLQWLM
FQMGGIGPMFGQVGFFHFFAGKEYEDKRPRDRYVNESKRLLGVLDRHLKGREWMVDEYSI
ADIAIFPWVRNLVERYNARDLVGFDQFKEVQRVLAAFLERPAVQRGLKIPG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcagtgcttttcccattacccgcaagtggcccgccagacaccccgagcgc
ctgcagctgtattcgttgccgacgcccaacggcgtcaaggtgtcgatcatgctcgaagag
atcggcctggcctatgagccgcacaaggtcagcttcgacaacgatgaccagctgagcccc
gagttcatctcgctcagcgccaacaacaagatccccgccatcctcgaccccaatggccct
ggcggccggccgctgccgctgttcgagtcgggggcgatcctgcagtacctggcagagaag
agcggccagttgctcagccaggacccggcccagcgttaccagaccttgcagtggctgatg
ttccagatgggtggcatcgggccgatgtttggccaggtcggattcttccatttctttgct
ggcaaggaatacgaggacaagcgcccgcgggaccgttatgtcaacgagtccaagcgcctg
ctcggtgttctggaccggcatctgaaaggccgggaatggatggtcgacgagtacagcatt
gccgatatcgcgattttcccgtgggtgcgtaacctggttgagcgttacaacgccagagat
ttggtaggcttcgatcagttcaaggaagtgcagcgggtgctggcggcgttcctcgagcgg
ccggccgtgcaacgcgggctgaaaattccaggttga

DBGET integrated database retrieval system