KEGG   Pseudomonas putida HB3267: B479_17880Help
Entry
B479_17880        CDS       T02389                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh00020  Citrate cycle (TCA cycle)
ppuh00190  Oxidative phosphorylation
ppuh00650  Butanoate metabolism
ppuh01100  Metabolic pathways
ppuh01110  Biosynthesis of secondary metabolites
ppuh01120  Microbial metabolism in diverse environments
ppuh01130  Biosynthesis of antibiotics
ppuh01200  Carbon metabolism
Module
ppuh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppuh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppuh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B479_17880
   00650 Butanoate metabolism
    B479_17880
  Energy metabolism
   00190 Oxidative phosphorylation
    B479_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AGA74468
UniProt: L0FN70
Position
complement(3934261..3934629)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgcg
accgactacctgacgcctatgtcgttcggcaagtcggctactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system