KEGG   Pseudomonas putida HB3267: B479_18585Help
Entry
B479_18585        CDS       T02389                                 

Definition
(GenBank) chemotaxis-specific protein-glutamate methyltransferase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
ppuh02020  Two-component system
ppuh02030  Bacterial chemotaxis
Module
ppuh_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B479_18585
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    B479_18585
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     B479_18585
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     B479_18585
Two-component system [BR:ppuh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   B479_18585
Bacterial motility proteins [BR:ppuh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    B479_18585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Stb3
Motif
Other DBs
NCBI-ProteinID: AGA74609
UniProt: L0FKZ2
Position
complement(4097239..4098366)
Genome map
AA seq 375 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRFGSYASHAPVAAPVPAPAGSGHAAASSFASPAAVRTPAPARAAAP
AHSPAPKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLD
KLCRISVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSA
AKSYGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAV
YSLDEIGKHLVEACV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattccggtttcttccgccgccgcgtctcggaa
atcctctcggcggatccgacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctgaagcccgatgtcatcaccatggactacgaaatgcccatg
atggacggcatcaccgcggtgcggcacatcatgcagcgctgcccgacgccggtgttgatg
ttctcgtcgctgacccatgaaggcgcccgtgtcaccctcgatgcgctggatgccggtgcg
gtggattacctgccgaagaacttcgaggacatctcgcgcaaccccgacaaggtcaagcaa
ctgctgtgcgagaaggtgcataccatttcccgcagcaaccgccgttttggcagctacgcc
agccatgcgccggttgccgcacccgtacccgcgccggcaggcagcggtcacgctgctgcc
agcagtttcgccagcccggcagcggtgcgcacgcctgcgcctgcccgtgcagcggcccca
gcgcattcgccggcacccaagcgcaagccatacaaactggtggccatcggtacctccacg
ggcggcccggtcgccctgcagcgggtgctgacccagctgccggccaacttcccggcgccg
atcgtactgatccagcacatgccggcggcattcaccaaggcctttgccgagcgcctggac
aagctgtgccgcatcagcgtcaaggaagccgaagacggcgacatgctgcgcccgggcctg
gccctgctggccccaggtggcaagcagatgatgatcgacggccgtggcacggtgaagatc
ctgcccggtgacgagcgcctgaactacaagccgtgcgtggacatcaccttcggctcggcg
gccaagtcgtatggcgacaaggtgctgtcggtggtgcttaccggcatgggcgccgatggc
cgtgaaggtgcgcgcctgctcaagcagggcggcagtacggtgtgggcccaggatgaagcc
agctgcgtgatctatggcatgcccatggctatcgtcaaggccaacctggccgacgcggtg
tacagcctggacgaaatcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system