KEGG   Pseudomonas putida HB3267: B479_22425Help
Entry
B479_22425        CDS       T02389                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B479_22425
   00670 One carbon pool by folate
    B479_22425
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     B479_22425
    1.5.1.-  
     B479_22425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4934319..4935056
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTAPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSVQPQAAHPNI
VQFQADLCQLADRQALIDYLHNHYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDETYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcggcaaccaaaggacagacaagttgaccgccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgcgtcgggctggccctggcccttgaactggcgcaggcc
ggccatacggtggtcagtgccagccgcagcgtccagccacaagcggctcacccgaacatc
gtgcagttccaggctgacctgtgccagctggccgatcgacaggccctgatcgactacttg
cacaaccattacgacggcctgcgcgcgatcatccacaacgcctcgttgtggctcgacgat
ggcctcgacaacctcgagaccatgttccgccttcacgtcgaagcgccctaccacctcaac
ctggccttgggcgacctgctggccaaggtggaaaaggccgacatcatccacatttgcgac
gaaacctcttcgcgcggcagcaaaagccacatcggctacgccgcgaccaaggccgcgttg
cagaacatggtgctgtctttcgccgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcccgggctgctgatcctcaaggaagggggtgacgaaacctaccgccagcagaccctg
aaaaaggccctgctggagttcgaacccggcgccggcccgctgatcgagacggtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacctga

DBGET integrated database retrieval system