KEGG   Pseudomonas putida HB3267: B479_22695Help
Entry
B479_22695        CDS       T02389                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B479_22695
Enzymes [BR:ppuh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B479_22695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4989980..4992055)
Genome map
AA seq 691 aa AA seqDB search
MSRSLVDLLPTPLHAEHLLALAPQHDSGDLLQLLDRWVERGWLRALDRAFVSFLEELAPG
SDPLLLLAAALASHQLGHGHVCLDLQQTLAEPDFALSLPPEGDALTGPLLLPSQLLADLD
LHAWRQRIAASPLVAAGDTSGQQARPLVLSGERLYLRRYWSYERRIDHTLRQRLTQSEAP
PADLRGRLAQLFDGGTPAGQVDWQKLACALATRAGFSIITGGPGTGKTTTVVRLLALLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQVSAQVRGQIPTEVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLDALPPRARLVLLGDKDQLASVEAGA
VLGDLCRDAEEGCYSPETEAWLEQTGGESLAGIGLKAGDEQRNPLAQQVVMLRFSRRFGE
GSGIGQLARLVNRQDSHAARNLLATPPPDVHSLALKHEQDRAFDRLLLDGLNRGSDGPQG
YRSYLRTLGRFRPALDTAVDDPAWEQWAGKVLHSFEDFQLLCAVRRGAWGVEGLNERVAR
VLHNAGLIDSQQPWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDERGEPLLRVAFPRNDG
SGGVRFVLPSRLNEVETVFAMTVHKSQGSEFSHTALVLPDALNPVLTKELVYTGITRAKH
CFSLVEPRQGIFEEAVARKVRRISGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagcctagtcgacctgttgcccaccccgctgcacgccgagcacctgcttgca
ttggcgccacagcatgacagcggtgacctgttgcaactgctcgaccgctgggtagagcgc
ggctggctgcgtgccctggaccgagcgttcgtatcattcctggaggagctagcccccggt
agtgacccactgctgttgctggccgccgccctggccagccaccaactgggccacggccat
gtctgcctcgacctgcagcagaccctggccgagcccgatttcgccctgtccttgccgcct
gaaggcgacgccttgaccggccccttgctgctgccttcgcagttgctcgccgacctcgac
ctgcacgcctggcgccagcgcattgccgccagtccgctagtggccgccggcgatacttcg
gggcagcaagcgcggcctttggtgctcagcggagagcgcctgtacttgcgccgttactgg
agttacgagcggcgcatcgaccatacacttcgccagcgcctgacccagtccgaagcgccc
ccggccgacttgcgtggccgcctggcgcagctgtttgacggtggtacgccggctggccag
gtggactggcagaagctcgcctgcgcccttgccacccgcgcaggcttcagcatcatcacc
ggcggccccggcacgggcaagaccactaccgtggtacgccttttggccttgctgcaggcg
ccggcggtggagcagggcaggccattgcgcattcgcctggccgcgccgaccggcaaggcg
gctgcgcgcctgaccgaatccattggccagcaggtcgagcgcctgcaggtcagcgcccag
gtgcgcgggcagatccccaccgaggtcagcaccgtgcaccgcctgctcggcagccgcccc
ggttcgcggcacttccgccaccatgccggcaacccgctgccgttggacgtgctggtggtc
gacgaagcgtcgatgatcgacctggaaatgatggccaacctgctcgatgccctgccgcca
cgggcacgcctggtactgctgggcgacaaggaccagctggcctccgtcgaggccggtgcg
gtactgggtgacctgtgccgggatgccgaggaggggtgttactcgccagagaccgaggca
tggctggagcagaccggtggcgaatcgctggcgggcatcggcctcaaggccggcgatgag
caacgtaatccgcttgcccagcaagtggtgatgctgcgcttctcgcggcgttttggcgaa
ggtagcggcattggccaactggcccggctggtcaatcgccaggactcccacgcggcccgc
aacctgctggccacgccgccgcccgatgtgcatagcctggccctgaagcacgaacaggac
cgcgccttcgaccgcctgctgctcgacggcctgaaccgcggcagcgacggcccgcagggt
tatcgcagctacctgcgtacccttggccgtttccgcccggcactcgataccgccgttgat
gaccccgcgtgggagcaatgggcgggcaaggtgctgcacagcttcgaagacttccagttg
ctgtgtgcggtacgccgcggcgcctggggtgtcgaaggcctcaacgagcgggtggcgcgg
gtactgcacaatgccgggctgatcgacagccagcagccctggtacgaagggcggccggtg
ctggtcacccgcaatgactacggcctgggcctgatgaacggtgacatcggcatcgccctg
cgtctgccggatgagcgcggcgaacccttgctgcgcgtggccttcccgcgtaacgacggc
agtgggggcgtgcgcttcgtcctgcccagccggctgaacgaagtggaaacggtattcgcc
atgaccgtgcacaagtcccaaggctcagagttcagccacaccgcgctggtgctgccggat
gcgctcaacccggtgctgaccaaggaactggtatacaccggcatcacccgcgccaagcat
tgcttcagcctggtcgagcctcgtcagggtattttcgaagaggcggtggcgcgcaaggtg
cggcgtatttccgggttgatgctggagcaggtgtag

DBGET integrated database retrieval system