KEGG   Pseudomonas putida HB3267: B479_25870Help
Entry
B479_25870        CDS       T02389                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppuh  Pseudomonas putida HB3267
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppuh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B479_25870
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B479_25870
   00650 Butanoate metabolism
    B479_25870
  Amino acid metabolism
   00360 Phenylalanine metabolism
    B479_25870
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B479_25870
   00622 Xylene degradation
    B479_25870
   00621 Dioxin degradation
    B479_25870
Enzymes [BR:ppuh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B479_25870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5708450..5709388)
Genome map
AA seq 312 aa AA seqDB search
MTTKRKVAIVGSGNIGTDLMIKILRNAEHLEMAVMVGIDPASDGLARAGRMGVATTHEGV
AGLVKMPEFADVDFVFDATSAGAHVKNDALLRATKPGIRVIDLTPAAIGPYCVPVVNLEQ
HVNAENLNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASKSAGPGTRANIDEFTETTS
KAIEAIGGAAKGKAIIIMNPAEPPLMMRDTVYVLSEAADQDHVEASIEEMVAAVNAYVPG
YRLKQKVQFEVIPDTAPLNIPGHGEFSGLKTSVFIEVEGAAHYLPAYAGNLDIMTSAALA
TAERMAQSMSQA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaaacgtaaagttgccatcgttggctccggaaacatcggcaccgatctgatg
atcaagatcttgcgtaatgccgagcacttggaaatggcagtgatggtcggtattgatccc
gcctcagatggcctggcccgtgccggtcgtatgggcgttgcgacaacccacgagggtgtt
gcgggtcttgtgaaaatgccggaattcgctgatgtcgatttcgtgttcgatgccactagc
gccggtgctcacgtcaaaaacgacgcgctgctgcgagcaaccaagcctggcatccgggtg
atcgacctgactcccgcggctattggtccatactgcgttcccgtcgtaaaccttgagcag
cacgtcaacgctgagaacctcaacatggtcacctgcggcggccaagcgaccattcccatg
gtggctgctgtatcgcgcgtcgccaaagtgcattacgcggaaattgttgcatcgattgcc
tctaaatccgctggtccaggtactcgagcgaacatcgacgagttcactgaaaccacctcg
aaggccatcgaggcgatcggcggtgcggcaaagggtaaagccatcatcatcatgaaccca
gcggagccgccgttgatgatgcgtgacactgtgtatgtcctttctgaagcagcagaccaa
gaccatgttgaggcctccatcgaagagatggttgctgcggtgaatgcttatgtaccgggc
tatcggttgaagcagaaagtgcagttcgaagtgatcccggacacggcgccgctgaacatc
ccaggccacggcgaattcagcggtctgaagacctctgtgtttatcgaggttgaaggggct
gcccattatctgccggcgtatgcgggcaatctcgacatcatgacttctgctgcgttggcg
actgctgaacgcatggcacagtcgatgagccaggcctga

DBGET integrated database retrieval system