KEGG   Pseudomonas putida NBRC 14164: PP4_03550Help
Entry
PP4_03550         CDS       T02707                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppun01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppun00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ppun00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
413845..415044
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEIVEIGRDVERLKIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPARLAHAKSQGFEVVDLSKD
TPLHEQIIDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGNIGIP
GLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTPTMKYNRQLMQAIMWDRINIA
EVVGVQVINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggagtggtatatctcggcgccggcaaggtcgaagtgcaacacatc
gactacccgaaaatgcaggacccgcgtggcaagaagatcgagcacggcgtcatcctgaag
gtggtctccaccaacatctgcggctctgaccagcacatggtccgtggccgcaccactgcc
caggtcggcctggttctgggccacgaaatcaccggtgaaattgtcgagatcgggcgtgac
gtcgaacgcttgaaaatcggtgacctggtgtcggtaccgttcaacgttgcctgcggccgc
tgccgctcctgcaaagagatgcacaccggcgtctgcctcaccgtcaacccggcccgcgcc
ggtggtgcctacggctacgtcgacatgggcgactggaccggcggccaggctgagtacgtg
ctggtgccatacgccgacttcaacctgctgaaactgccggaccgcgacaaggccatggaa
aagatccgtgacctgacatgcctgtccgacattctgcctaccggctaccacggtgccgtg
acggctggcgtaggcccaggcagcaccgtttacgttgcgggcgctggcccggtcggcctg
gccgctgctgcctcggcccgcctgctgggcgcggcctgcgtcatcgtcggtgacctgaac
ccggcccgcctggcccacgccaagtcgcaaggctttgaagtggtcgacctgtccaaggac
accccgctgcacgagcagatcatcgacatcctcggtgagccggaagtggactgcgccgtc
gacgccgtcggcttcgaggcccgtggccatggtcacgaaggtgccaagcacgaggccccg
gccaccgtgctgaactcgctgatgcaagtgacccgcgtggccggcaacatcggtatcccg
ggcctgtacgtaaccgaagacccaggcgcggtagatgccgctgccaagatcggcgcgctg
agcatccgcttcggcctgggctgggcgaagtcgcacagcttccacaccggccagaccccg
accatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccgtatcaacattgct
gaagtggtgggggtgcaggtgatcaacctggatcaggcgccagaagggtatggcgagttt
gatgcgggtgtaccgaagaagtttgtgattgacccgcacaagatgtggggcgcggcgtga

DBGET integrated database retrieval system