KEGG   Pseudomonas putida NBRC 14164: PP4_05140Help
Entry
PP4_05140         CDS       T02707                                 

Gene name
katA
Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PP4_05140 (katA)
  Amino acid metabolism
   00380 Tryptophan metabolism
    PP4_05140 (katA)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PP4_05140 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589922..591361
Genome map
AA seq 479 aa AA seqDB search
MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNRENIPERRVHAKGSGAY
GTFTVNRDITHYTSAKLFEQIGKQTDTFLRFSTVGGERGSADTERDPRGFAVKFYTEEGN
WDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMMWDFWSHSPEALHQVTILFSD
RGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQGIKNLAPADAARLAGTDPDYAQ
RDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFDVTKTWSQKDYPLIEVGVLELNRNP
LNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVFAYADAHRYRVGTNHQHLPVNAPRCAV
NSYQRDGSMATGSYGSAPNYEPNSYAEAPKQSPRHAEPALALNGSADRYDHREDTDYFSH
AGALFRLMSDEQKALLISNIAGTMAGVSEDVIQRQLQYFFKADPAYGEGIAKALGINLA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattcttaccaccgccagcggtgcaccagtagccgacaaccagaactcccgt
tccgccggcccgcgtggcccgctgttgctcgacgacttccacctgatcgagaagctcgca
catttcaaccgcgagaacattcctgagcgccgcgtacacgccaaaggctcgggcgcctat
ggcacctttaccgtcaaccgcgatataacccactacaccagcgcaaagctgtttgagcag
atcggcaagcaaacagataccttcctgcggttctccactgttggcggtgaacgtggctct
gcagataccgagcgagatcctcgtggctttgccgtcaagttctacaccgaggaaggcaac
tgggacatcgtgggtaacaacacgccagtgttcttcattcgcgacccgctgaagtttccg
gactttatccacacccagaagcgccatccgcaatccaacctgaagaacgcccagatgatg
tgggatttctggtcgcactcgcccgaggcgctgcaccaggtcacgatcctgttctcggac
cgtggtattccggacggctatcgccatatgcacggcttcggcagccacacgtacagcttg
atcaacgccaagggcgagcgtacctgggtcaaatggcatttcaagacccagcaaggtatc
aagaacctcgcgccggcagatgctgcacgcctggcgggtactgacccggactacgcccag
cgcgacctgttcgaagccattgaacgtggcgactacccgcgttggaccgtatgcattcag
gtcatgagcgaagccgaggcagccagccgcgacgagaaccccttcgacgtcaccaagacc
tggtcgcagaaggattatccgttgatagaggtgggcgtgctggagctcaaccgtaatccg
ctcaactacttcgccgaagtcgagcaggctgcgttcgggccgagcaacatggtgccaggg
gttggcctgtcgccggaccgcatgctgcagggccgtgtattcgcttacgcagacgcacac
cgctaccgtgtgggcaccaaccaccagcacttgccggtgaatgccccacgctgcgcagtc
aacagctaccagcgcgacggctccatggccactggcagttacggcagtgcaccgaactac
gagcccaacagctacgctgaggcaccgaagcagtcgccacgccatgctgaacccgcgctg
gccctgaacggttcggcagaccgttacgatcaccgtgaggacaccgactacttcagtcac
gccggcgcgttgttccgcctgatgagcgatgagcagaaggcactgctgatcagcaacatt
gccggcaccatggcaggtgtcagcgaagacgtgatccagcgccagttgcagtacttcttc
aaggctgacccggcctatggcgaagggattgccaaggcgttgggcatcaacctggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system