KEGG   Pseudomonas putida NBRC 14164: PP4_17080Help
Entry
PP4_17080         CDS       T02707                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP4_17080 (malQ)
Enzymes [BR:ppun01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PP4_17080 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1984069..1986138)
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLANRVGLSRDWIDANARPQRVSDEVLRTILEGLGHAAADDDAIAISLRTVEA
AEDSEHLPPLLTADLGKPLALARYFSAASVAHCTLEDHASLTLKLDDQARLPGELPIGYH
QVEIDSRHFTVAVAPPRCHSLEDTVQQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RSAAERGADALAISPIHTLSAIDQEHYSPYSPSSRLLLNTLYASPAALLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSQGDHPLRSDFDSFREAGGQALEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEAFANAYPAKVEFHAFCQWLTERGL
QRAQEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPV
DDLLRLLALESVRHQAIILGEDLGTVPDGLRETLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLENRDIDWSHRLQLIDAATEQHWRQGRQIEHDGLRRTLET
NYGELKDNDAVIDAAIRFVGHTRAPLVLIPLEDLLGCDEQPNLPGTTSGHPNWRRRFTRP
VTELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgcttggcaaaccgcgtcgggttgagccgcgactggatc
gacgccaatgcccgaccccagcgcgtcagtgacgaggtgctgcgcaccattcttgaaggc
ctgggccacgctgccgctgacgacgacgccatcgccatcagcctgcgcacggtggaagcc
gccgaagacagcgaacacctgccgcccctgctgaccgcagacctgggcaagcccttggcg
ctggcgcgttacttcagcgccgccagcgtcgcccactgcaccctggaagaccacgcctca
ctcaccctgaaacttgacgaccaggcacgcctgcccggtgagctgccaatcggctaccac
caggtggaaatcgacagccgccacttcaccgtggccgtggccccgccccgctgccacagc
ctcgaagacacggtgcaacagccaccaccacgctgttggggcctggccgtgcagctgtac
agcctgcgccgccccggcgatggcggctacggcgactgcctggcgctggagcagctggcc
cgctcggctgccgagcgcggtgccgatgccttggccatcagccccatccatacactgtcg
gccatcgaccaggagcactacagcccctactcgccctccagccgcctgttgctcaacacc
ctgtacgccagccccgccgccctgctgggcgaacgggaggtacgcatggccatcgaagcc
tgcgggctggagcaacaactggaagaacttgagcaacgcccgctggtcgactggccacgc
gccgccagcgcccgcctgcgcctgcttgaagcgctgtaccagggtttcagccagggtgac
cacccgctgcgcagcgattttgacagcttccgcgaagcgggcggccaggcgctggagcac
cactgccgcttcgaggtgctgcaagcccaggccgtggagcacggcctgggtgccgactgg
cgcaactggcccaaggcctggcacgacccctaccacccggaagttgaagcctttgccaat
gcctacccggccaaggtcgagttccatgccttctgccaatggctgaccgagcgcggcctg
caacgtgcccaggaagcagcccgcggcaacggcatggcagtgggcctgatcgccgacctg
gcggtgggtgccgacggtgccggcagccaggcctggagccgccaggacgaattgctggcg
ggcctgaaagtaggcgcgccacccgacatcctcaaccgcgccggtcaagactggggcatc
tgtgcgttctcgcccgaaggcctcaagcgcaacggctaccgcgctttcatcgagatgctg
cgggccaatctggcccatgccggtggcttgcgcatcgaccatgtgatgggcctgcgccgg
ctatggctgatcccgcagggggccaagcccagcgaaggcgcttacctcaattacccggtg
gacgacctgttgcgcctgctggcgctggagtcggtgcgccaccaggcgatcattctcggt
gaagacctgggcaccgtgcccgacggcctgcgcgaaacactggccgagaaggccgtgctg
ggcatgcgcgtgctgccgttcgagcaaacccagcccggccagttcaaaccgatactggac
tggccggacaacgccctggccaccaccggcacccacgacctggcaccgctggccggctgg
ctggaaaaccgcgacatcgactggagccaccgcttgcaactgatcgacgctgccaccgaa
cagcactggcgccaaggccgccagatagaacacgacggcctgcgccgtaccctggagacc
aactacggtgaactgaaggacaacgacgcggtgatcgatgcggccatccgcttcgttggc
catacccgtgcgcccttggtgctgataccgctcgaagacctgctgggctgcgacgagcag
cccaacctgccgggcaccaccagcgggcaccccaactggcggcggcgcttcacccggccg
gtgacagaactgctcgatgacgaggatgccgcgcggcgcctggagctgctggcccaggcc
cgcgaacaggcttgggagcgtgaccgatga

DBGET integrated database retrieval system