KEGG   Pseudomonas putida NBRC 14164: PP4_19560Help
Entry
PP4_19560         CDS       T02707                                 

Gene name
lao
Definition
L-amino acid oxidase (EC:1.4.3.2)
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP4_19560 (lao)
   00330 Arginine and proline metabolism
    PP4_19560 (lao)
   00340 Histidine metabolism
    PP4_19560 (lao)
   00350 Tyrosine metabolism
    PP4_19560 (lao)
   00360 Phenylalanine metabolism
    PP4_19560 (lao)
   00380 Tryptophan metabolism
    PP4_19560 (lao)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PP4_19560 (lao)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2230144..2231724)
Genome map
AA seq 526 aa AA seqDB search
MGLTRRDLIAHLMAAGSYGAALGSLSALGLLPTAATASTFQPLGLPTTSGNGKRVLVVGA
GISGLVAAYELGKAGFEVRVLEARERIGGRAWTLRNGDEVLHNDGSRQQVRFDNGHYFNA
GPARLPSHHLTILGYCRELGVPLEVLVNSSRNALAQPDLAQPPLLLRQAVNDTRGHLSEL
LSRSISGKALDKELDTGDQKALLDFLKVYGDLDEQRHYKGSVRAGYTRFAGAGDQTPIQR
QPVALRQLLNPNLMLPLVFDEIPEFSATMFQPVGGMDQIAKALYAKVQDKVQLHAEVLAI
RTGDNASQVTWRDRRSGKTQVETADYAIVTIPLPLLARVDHNFGKTTQAAIAQAKPDLAN
KVAWQAPRFWESEFQIYGGLSYINHEARLLWYPSDHLNSAQGILVGTYNTGEVARTFATR
STEQQLASSRQAVESLHPGHAGKLQRGVAVNWSKVPFSESPWIVHDVLAEPGYSHLNQPQ
GRTWLASDALAHGGVGIWQNSAADSARHVVGQIARHALQQQRGVAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgacccgtagagaccttattgcccacctgatggccgctggcagctacggcgcc
gcgcttggcagcctgtccgcgctgggcctgttgcctactgcggccacggccagcaccttc
cagccgctgggcctgccgaccacgtccggcaacggcaagcgcgtgctggtggtgggggct
ggcatcagcggcctggtggcagcctatgaacttggcaaagccggttttgaggtgcgcgtg
ctggaagcccgggagcgaatcggcgggcgtgcgtggacgctgcgcaacggcgacgaggta
ctgcacaatgacggcagccgccagcaggtgcgtttcgacaacggccactatttcaatgca
gggcccgcacgcctgcccagccatcacctgaccatcctcggctactgccgcgagctgggc
gtcccgctggaagtgctggtcaacagcagccgcaacgccctcgcccaaccggaccttgcg
cagccaccgttactgctgcgccaggcggtgaatgacacccgtgggcacctcagcgaactg
ctgtcgcgcagcatcagcggcaaagcgctggacaaggaactggacaccggcgaccagaag
gccctgttggactttctaaaggtatacggcgacctcgacgagcagcgccattacaagggc
tcggtccgcgccggctatacccgcttcgccggggcgggcgaccagaccccgatccagcgc
cagcccgtggcactcagacaactgctaaaccctaacctgatgctgccgctggtattcgac
gagatcccggagttttccgccaccatgttccagccggtcggcggcatggaccagattgcc
aaagccctgtacgccaaggtgcaggacaaggtgcaactgcacgccgaagtgctggcaatc
cgcaccggcgacaacgcgagccaggttacctggcgtgaccgtcgcagcggcaagacccag
gtggaaaccgccgactacgccatcgtcaccattcccctgccactgctggcccgggtcgac
cacaactttggcaagaccacccaggcggccatcgcccaggccaagccagacctggccaac
aaggtggcatggcaggcgcctcgtttctgggaaagcgagttccagatctacggcgggctc
tcctacatcaaccacgaagcgcggctgctgtggtaccccagcgaccacctgaacagtgcc
cagggcatcctggtgggcacctacaacaccggcgaagtggcgcgcacattcgccacgcgt
tcgacagagcagcaactggcgtcgtcgcgccaggccgtggagtcgctgcacccgggccat
gccggcaagttgcagcgcggggtggcggtgaactggtccaaggtgccgttcagcgaaagc
ccatggattgtccacgacgtgctggccgaacccggctactcgcacctcaaccagccccag
ggccgcacctggctggccagcgatgcactggcccatggcggggtgggcatctggcagaac
agcgctgcggactcggcacgccatgtggtcgggcagatcgcccggcacgccctgcaacag
caacgcggcgtcgccgcctga

DBGET integrated database retrieval system