KEGG   Pseudomonas putida NBRC 14164: PP4_27270Help
Entry
PP4_27270         CDS       T02707                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PP4_27270 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP4_27270 (mhpF)
   00650 Butanoate metabolism
    PP4_27270 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP4_27270 (mhpF)
   00622 Xylene degradation
    PP4_27270 (mhpF)
   00621 Dioxin degradation
    PP4_27270 (mhpF)
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PP4_27270 (mhpF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     PP4_27270 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3097618..3098547
Genome map
AA seq 309 aa AA seqDB search
MSKKIKCALIGPGNIGTDLLYKLKRSEVLEPVWMVGIDATSEGLARAAALGLKTTSEGVD
GLLPHVLEDGIQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKHNLG
LGAMNVNMVTCGGQATIPLVAAVSSVQPVAYAEIIATAASKSVGPGTRKNIDEFTRTTAA
AVEQVGGAKKGKAIIIVNPAEPPLIMRDTVHCLTETEPDQAAITVAIADMIKQVQRYVPG
YKLVNGPVFDGNRVSIFMEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEAMLKGELTLR
ASTPQPAIA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagataaaatgcgccctcatcgggcccggcaacatcggtaccgacctgctg
tacaagctcaagcgcagtgaagtactggaacccgtctggatggtgggtatcgacgccacc
tccgaaggccttgcccgcgccgccgcgctgggcctgaaaaccaccagcgagggcgtcgat
ggcctgctaccgcatgtactggaagacggcatccagatcgccttcgatgctacctccgcg
tatgtgcatgccgaaaacagccgcaagctcaatgccttgggtgtgctgatgatcgacctg
actccggcagccatcggcccctactgcgtgccaccggtcaacctgaagcacaaccttggc
ctgggcgcgatgaacgtcaacatggtgacctgtggcggccaggcgaccatcccgctggtg
gccgcggtgtccagcgtgcagccggtggcctatgccgagatcattgccacggcggcctcg
aaatcggtcggcccgggcacacgcaagaacatcgatgaattcacccgcaccaccgcggcg
gccgtggaacaggttggcggcgcaaaaaagggcaaggcaatcattatcgtcaaccccgcc
gagccgccgctgatcatgcgcgacaccgtgcactgcctgaccgaaaccgagcctgaccag
gcagccatcaccgtcgcgattgccgacatgatcaagcaagtccagcgctatgtgcccggc
tacaagctggtcaacggcccggtgttcgacggtaaccgggtatcgattttcatggaagtc
gaaggcctgggcgactacctgcccaagtatgccggcaacctcgacatcatgaccgccgcc
gccgcgcgcaccgccgagatgtttgccgaagcaatgctcaaaggcgagctgaccctgcgt
gccagcaccccacaacctgccatcgcctaa

DBGET integrated database retrieval system