KEGG   Pseudomonas putida NBRC 14164: PP4_27270Help
Entry
PP4_27270         CDS       T02707                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppun00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppun00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ppun00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ppun00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ppun00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3097618..3098547
Genome map
AA seq 309 aa AA seqDB search
MSKKIKCALIGPGNIGTDLLYKLKRSEVLEPVWMVGIDATSEGLARAAALGLKTTSEGVD
GLLPHVLEDGIQIAFDATSAYVHAENSRKLNALGVLMIDLTPAAIGPYCVPPVNLKHNLG
LGAMNVNMVTCGGQATIPLVAAVSSVQPVAYAEIIATAASKSVGPGTRKNIDEFTRTTAA
AVEQVGGAKKGKAIIIVNPAEPPLIMRDTVHCLTETEPDQAAITVAIADMIKQVQRYVPG
YKLVNGPVFDGNRVSIFMEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEAMLKGELTLR
ASTPQPAIA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagataaaatgcgccctcatcgggcccggcaacatcggtaccgacctgctg
tacaagctcaagcgcagtgaagtactggaacccgtctggatggtgggtatcgacgccacc
tccgaaggccttgcccgcgccgccgcgctgggcctgaaaaccaccagcgagggcgtcgat
ggcctgctaccgcatgtactggaagacggcatccagatcgccttcgatgctacctccgcg
tatgtgcatgccgaaaacagccgcaagctcaatgccttgggtgtgctgatgatcgacctg
actccggcagccatcggcccctactgcgtgccaccggtcaacctgaagcacaaccttggc
ctgggcgcgatgaacgtcaacatggtgacctgtggcggccaggcgaccatcccgctggtg
gccgcggtgtccagcgtgcagccggtggcctatgccgagatcattgccacggcggcctcg
aaatcggtcggcccgggcacacgcaagaacatcgatgaattcacccgcaccaccgcggcg
gccgtggaacaggttggcggcgcaaaaaagggcaaggcaatcattatcgtcaaccccgcc
gagccgccgctgatcatgcgcgacaccgtgcactgcctgaccgaaaccgagcctgaccag
gcagccatcaccgtcgcgattgccgacatgatcaagcaagtccagcgctatgtgcccggc
tacaagctggtcaacggcccggtgttcgacggtaaccgggtatcgattttcatggaagtc
gaaggcctgggcgactacctgcccaagtatgccggcaacctcgacatcatgaccgccgcc
gccgcgcgcaccgccgagatgtttgccgaagcaatgctcaaaggcgagctgaccctgcgt
gccagcaccccacaacctgccatcgcctaa

DBGET integrated database retrieval system