KEGG   Pseudomonas putida NBRC 14164: PP4_29310Help
Entry
PP4_29310         CDS       T02707                                 

Definition
(GenBank) putative catalase
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP4_29310
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PP4_29310
  Amino acid metabolism
   00380 Tryptophan metabolism
    PP4_29310
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     PP4_29310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3331044..3332096
Genome map
AA seq 350 aa AA seqDB search
MTMNSPLHGPAKAVRLAAIGAVMLAAGAGFAYAAGWLGESRLTPQRIIDTFEAQAGHYPG
YRKNHAKGLCVSGYFQASGQAANLSTARVFSQARVPVTGRFAIGGANPFAPDTGIPVRSL
AIQLSTDDGQVWRTGMNNPPVLAISTPQGFYEQVLANTPDPATGKPNPASLQAFFAAHPE
SAAFRQWAAGYKPSNSFASTQYHSINAFHLIDAGGTRHPVRWQLEPQTAFAALPTQIDDK
QFLQHDLQQRLAQGPLRWTLRLVLAEPGDAVDDPARPWPAERRSVDAGTLVLEQVDAPEQ
GACRDLNFDPLILPRGIEASADPILAARSAAYSESFNRRSRESLSTGARP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaactcacctttgcacggcccggcgaaagccgtgcgcctggctgccatcggc
gccgtgatgctggccgcaggcgccggctttgcctacgccgccggctggctcggcgaaagc
cggctgacgccacagcgtatcatcgataccttcgaggcccaggccgggcattacccaggc
taccggaagaaccatgccaagggcctgtgcgtcagcggctacttccaggccagcgggcag
gccgccaacctttctactgcgcgcgtcttcagccaggcacgcgtgccggtaaccggccgt
ttcgccattggcggtgccaacccgttcgcaccggacaccggcatacccgtgcgcagcctg
gccattcagctgagtaccgacgacgggcaggtatggcgcaccggcatgaacaacccgcca
gtgctggcaatcagcacaccgcaagggttctacgagcaagtgctggccaacacgccagac
ccggccaccggcaaaccgaaccctgccagcctgcaggcgtttttcgcagcccacccggag
agcgcggcgtttcgccaatgggcggcgggctataagcccagcaacagcttcgccagcacc
caataccacagtatcaacgcctttcacctgatcgacgcaggcggcacgcgccacccggtg
cgctggcagcttgagccgcaaaccgcgtttgccgcgctgcccacccagatcgatgacaaa
cagtttctacaacacgacctgcagcaacgcttggcccagggccccttgcgctggacgctt
cgcctggtgctggccgaacccggcgatgcggtggatgaccctgcccggccctggcccgcc
gagcggcgcagcgtagacgccggcaccctggtgctggaacaggtcgacgcccctgagcag
ggggcatgccgcgacctcaatttcgacccgttgatcctgccccgaggcatagaggcatct
gccgacccgatcctcgccgcccgttcggctgcctactcggaatcgttcaaccgccgcagc
cgtgaatcgctcagcaccggagcccgcccatga

DBGET integrated database retrieval system