KEGG   Pseudomonas putida NBRC 14164: PP4_29310Help
Entry
PP4_29310         CDS       T02707                                 

Definition
putative catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppun00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ppun00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3331044..3332096
Genome map
AA seq 350 aa AA seqDB search
MTMNSPLHGPAKAVRLAAIGAVMLAAGAGFAYAAGWLGESRLTPQRIIDTFEAQAGHYPG
YRKNHAKGLCVSGYFQASGQAANLSTARVFSQARVPVTGRFAIGGANPFAPDTGIPVRSL
AIQLSTDDGQVWRTGMNNPPVLAISTPQGFYEQVLANTPDPATGKPNPASLQAFFAAHPE
SAAFRQWAAGYKPSNSFASTQYHSINAFHLIDAGGTRHPVRWQLEPQTAFAALPTQIDDK
QFLQHDLQQRLAQGPLRWTLRLVLAEPGDAVDDPARPWPAERRSVDAGTLVLEQVDAPEQ
GACRDLNFDPLILPRGIEASADPILAARSAAYSESFNRRSRESLSTGARP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaactcacctttgcacggcccggcgaaagccgtgcgcctggctgccatcggc
gccgtgatgctggccgcaggcgccggctttgcctacgccgccggctggctcggcgaaagc
cggctgacgccacagcgtatcatcgataccttcgaggcccaggccgggcattacccaggc
taccggaagaaccatgccaagggcctgtgcgtcagcggctacttccaggccagcgggcag
gccgccaacctttctactgcgcgcgtcttcagccaggcacgcgtgccggtaaccggccgt
ttcgccattggcggtgccaacccgttcgcaccggacaccggcatacccgtgcgcagcctg
gccattcagctgagtaccgacgacgggcaggtatggcgcaccggcatgaacaacccgcca
gtgctggcaatcagcacaccgcaagggttctacgagcaagtgctggccaacacgccagac
ccggccaccggcaaaccgaaccctgccagcctgcaggcgtttttcgcagcccacccggag
agcgcggcgtttcgccaatgggcggcgggctataagcccagcaacagcttcgccagcacc
caataccacagtatcaacgcctttcacctgatcgacgcaggcggcacgcgccacccggtg
cgctggcagcttgagccgcaaaccgcgtttgccgcgctgcccacccagatcgatgacaaa
cagtttctacaacacgacctgcagcaacgcttggcccagggccccttgcgctggacgctt
cgcctggtgctggccgaacccggcgatgcggtggatgaccctgcccggccctggcccgcc
gagcggcgcagcgtagacgccggcaccctggtgctggaacaggtcgacgcccctgagcag
ggggcatgccgcgacctcaatttcgacccgttgatcctgccccgaggcatagaggcatct
gccgacccgatcctcgccgcccgttcggctgcctactcggaatcgttcaaccgccgcagc
cgtgaatcgctcagcaccggagcccgcccatga

DBGET integrated database retrieval system