KEGG   Pseudomonas putida NBRC 14164: PP4_32190Help
Entry
PP4_32190         CDS       T02707                                 

Gene name
bcsZ
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP4_32190 (bcsZ)
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PP4_32190 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3657580..3658695)
Genome map
AA seq 371 aa AA seqDB search
MMRRLLVGLVTFGLPFFANAAPACPWPAWDRFKAELVSVDGRVIDPSDERLITTSEGQSY
ALFFALVGNDRQAFAQLLRWTTNNLAEGDLARHLPAWLWGRNSQQQWQVLDTNNASDADL
WIAYSLLEAGRLWGEPAYTQLGQRLLWRIAAQTMRKLPGLGVMLLPGDYGFEDARGTRLN
PSYLPLQLFDRFNLVDPLWGELATNTRRLWLASSPKGFAPDWLLWTPAGELAADPQHGSA
GDYDAIRVYLWVGMLAKDAPQRADLVARYAPMAALTTLDGLPPEHVDARSGAASGHGPAG
FSAALLPLLAASPEHVAGLAAQRQRLHQQPVEAKAYYSQVLALFGQGWDEARYRFDPHGR
LLPAWSKPCSE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccgattgctggtggggctggtcaccttcggcctgcctttcttcgccaatgcc
gcgccggcctgcccgtggccggcctgggaccgcttcaaggccgagctggtgagtgtggac
ggccgggtcatcgacccgagcgacgagcgcctgatcaccacctcggaagggcagagctat
gcattgttctttgccctggtaggcaatgaccggcaggccttcgcgcaattgctgcgctgg
accaccaacaacctggccgagggtgacctggcccggcatcttcccgcttggctgtggggc
cgtaacagccaacagcagtggcaggtgctggataccaacaacgccagcgacgccgacctg
tggattgcatacagcctgctggaagcggggcggttgtggggcgaaccggcctacacgcaa
ctgggccagcgcctgctgtggcgcatcgctgcgcagaccatgcgcaagctgccaggcctg
ggggtgatgttgctgccgggcgactacggtttcgaggatgcccgtggcacacgcttgaac
cccagttatctgccgttgcaactgttcgaccgcttcaacctggtagacccgctgtggggt
gagttggcgaccaatacgcggcgcttgtggctggcgtcatcgcccaagggcttcgccccg
gactggctgctgtggacgccggccggtgagctggccgcggacccacaacatggcagcgcc
ggtgattacgacgccatccgggtttacctgtgggtcggcatgctggccaaggacgctccc
cagcgtgccgacctggtggcccgctatgccccgatggcggcattgacgacgcttgacggg
ctgccgcccgagcacgtggatgcgcgcagcggtgctgcgagcggccatggcccggcaggc
ttctctgcggccctgctgcctttgctggcggcttctcccgagcacgtggctggcctggca
gcgcagcggcagcgtttgcatcagcagccggtcgaagccaaggcgtactacagccaggtg
ctggcgctgtttggccagggttgggacgaagcccgttaccgttttgacccgcacggccgc
ctgttgccggcctggagcaagccatgcagcgaatga

DBGET integrated database retrieval system