KEGG   Pseudomonas putida NBRC 14164: PP4_37690Help
Entry
PP4_37690         CDS       T02707                                 

Gene name
gdhB
Definition
NAD(+)-dependent glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ppun00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppun00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppun00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:ppun00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4286250..4291115)
Genome map
AA seq 1621 aa AA seqDB search
MAFFTAASKADFQHQLQAALAQHISEQSLPQVALFAEQFFGIISLDELTQRRLSDLAGCT
LSAWRIIERFDPEYPQVRVYNPDYERNGWQSTHTVVEVLHHDLPFLVDSVRTELNRRGYS
IHTLQTTVLSVRRGAKGELLELLPKGTQGEGVRHESLMYLEIDRCANAAELTVLTREIEQ
VLAEVRVAVADFEPMKAKLREVVAQVEQTAFGPAQNEKGEVKAFLEWLLDNHFTFLGYEE
FTVKGDADGGQMVYDEQSFLGLPRRLRVGLTAEELRIEDYAVAYLNEPLLLSFAKAALPS
RVHRPAYPDYVSIRQLDADGKVIKEHRFMGLYTSSVYGESVHAIPYIRVKVAEVERRSGF
DAKAHLGKELAQVLEVLPRDDLFQTPIDELFTTVMAIVQIQERNKIRVFLRKDPYGRFCY
CLAYVPREIYSTEVRQKIQQVLMERLKASDCEFWTFFSESVLARVQLILRVDPKNRIDID
PQQLEREVIQACRSWHDDYSTLVVENFGEAQGTNILADFPKGFPAGYRERFAAHSAVVDL
QHVLNLSESKPLAMSFYQPLTQVGERILHCKLYHADTPLALSDVLPILENLGLRVLGEFP
YRLRHANGREYWIHDFAFTYSEGLSLDIQQLNDTLQDAFIHIVRGDAENDAFNRLVLTAG
LPWRDVALLRAYARYLKQIRLGFDLGYIASTLNNHTDIARELTRLFKTRFYLARKLTQED
LDDKQLRLEQAILTALDDVQVLNEDRILRRYLDLIKATLRTNFYQPDANGQNKSYFSFKF
NPKLIPELPKPVPKFEIFVYSPRVEGVHLRFGNVARGGLRWSDREEDFRTEVLGLVKAQQ
VKNSVIVPVGAKGGFLPRRLPLGGGRDEIAAEGVACYRIFISGLLDITDNLKDGGVVPPA
NVVRHDDDDPYLVVAADKGTATFSDIANGIAIDYGFWLGDAFASGGSAGYDHKKMGITAR
GAWVGVQRHFRERGINVQEDPITVIGVGDMAGDVFGNGLLMSDKLQLVAAFNHLHIFIDP
NPEPASSFAERKRLFDLPRSAWSDYDTSIMSEGGGIFPRSAKSIAISPQMKERFAIEADR
LTPTELLNALLKAPVDLLWNGGIGTYVKASTESHADVGDKANDALRVNGNELRCKVVGEG
GNLGMTQLGRVEFGLNGGATNTDFIDNAGGVDCSDHEVNIKILLNEVVQGGDMTEKQRNQ
LLGSMTDEVAGLVLGNNYKQTQALSLAARRARERIAEYKRLMADLEARGKLDRAIEFLPS
EEQLAERLAAGHGLTRAELSVLISYSKIDLKEQLLKSLVPDDDYLTRDMETAFPPSLVSK
FAHSMRRHRLKREIVSTQIANDLVNNMGITFVQRLKESTGMSPANVAGAYVIVRDIFHLP
HWFRQIEALDYQVPAEIQLTLMDELMRLGRRATRWFLRSRRNEQDAGRDTAHFGPKIAQL
GLKLDELLEGPTRERWMVRYQGFVDAGVPELLARMVAGTSHLYTLLPIIEAADVTGHDPA
QVAKAFFAVGSSLDLTWYLQEISNLPVENNWQALAREAFRDDIDLQQRAITISVLQMADA
PDDMDARVALWAEQHRVMVERWRAMLDDLRNATGTDYAMYAVANRELVDLAMSGQATVVP
S
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcttcaccgcagccagcaaagccgacttccagcatcaactgcaagcggccctg
gcgcagcacatcagcgaacagtccctgccacaagtggcgctgttcgccgagcagttcttc
ggcatcatctctctggacgaactcacccagcgcaggctttccgacctggccggctgcacc
ctgtcagcctggcgcatcatcgaacgtttcgaccccgaatacccgcaagtacgcgtatac
aaccccgattacgaacgcaatggctggcagtcgacccataccgtggtcgaggtgctgcac
cacgacctgccgtttttggtcgactctgtgcgcaccgagctcaaccgccgcggctacagc
atccacaccctgcagaccaccgtgctcagcgtgcgccgcggcgccaagggcgaactgctg
gaactgctgcccaagggcacccagggcgaaggcgtgcgccatgagtcgctgatgtatctg
gagatcgaccgctgcgccaatgctgccgagctgaccgtgctgacccgcgagatcgagcag
gtgctggccgaggtacgggtggccgtggccgacttcgagccgatgaaggccaagctgcgt
gaagtggtggcgcaggttgaacagaccgcctttggcccagcccagaacgagaagggcgag
gtcaaagcgttcctggagtggttgctggacaaccatttcaccttcctgggctatgaagaa
ttcaccgtcaagggcgacgccgacggcggccagatggtctacgacgagcagtcgttcctc
ggcctgccgcgccgcctgcgtgtgggcctgacggccgaagagctgcgcatcgaagactac
gccgtggcttacctcaacgaaccgctgctgctgtcgtttgccaaggccgcgctgcccagc
cgcgtgcaccgcccggcctacccggactacgtgtcgatccgccagctggacgccgacggc
aaagtcatcaaggaacaccgcttcatgggcctgtacacctcgtcggtgtatggcgagagc
gtgcatgccattccgtatatccgcgtcaaggtggctgaagtcgagcgccgctcgggcttc
gacgccaaggctcacctgggcaaggaactggcccaggtactggaagtactgccgcgcgac
gacctgttccagacgccgatcgacgagctgttcaccaccgtcatggcgatcgtgcagatc
caggaacgcaacaagatccgcgtgttcctgcgcaaggacccgtacggccgcttctgctac
tgcctggcctatgtgccgcgggagatctactccaccgaagtacggcagaagattcagcaa
gtgctgatggagcgcctgaaggccagcgactgcgagttctggaccttcttctccgaatcg
gtgctggcacgcgtgcagctgattttgcgcgtagacccgaaaaaccgcatcgacatcgac
ccgcagcagctggaacgcgaagttatccaggcctgccgctcgtggcatgacgactattcg
acgctggtggtcgagaacttcggtgaagcccagggcaccaacatcctggccgatttcccc
aagggcttcccggccggctaccgtgagcgcttcgccgcgcactcggcagtggtcgacctg
cagcacgtgctgaacctgtcggaaagcaagccgctggcgatgagcttctaccagccgctg
acccaggttggcgagcgtatcctgcactgcaagctgtaccacgccgatacgcccctggcg
ttgtctgacgtgctgccgatcctggaaaacctcggcctgcgtgtgctcggcgagttcccg
taccgcctgcgccatgccaatggtcgcgagtactggatccacgacttcgccttcacctac
agcgaaggcctgagcctggatatccagcagctcaacgacaccctgcaggacgccttcatt
cacatcgtgcgcggcgatgccgagaacgacgccttcaaccgcctggtgctcactgccggc
ctgccatggcgcgacgtggcgctgctgcgcgcctacgcccgttacctgaagcagatccgc
ctgggcttcgacctgggctacatcgccagcaccctgaacaaccacaccgacatcgcccgc
gagctgacccggttgttcaagacccgcttctacctggcccgcaagctcacccaggaagac
ctggacgacaagcagctgcgcctggaacaagcgatcctgaccgcgctggacgacgtgcag
gtcctcaacgaagaccgcatcctgcgccgctacctggacctgatcaaggctaccctgcgc
accaacttctaccaaccggatgccaacggccagaacaagtcgtacttcagcttcaagttc
aaccccaagctgatccccgaactgcccaagccggtgcccaagttcgaaatcttcgtctat
tcaccgcgcgtcgagggcgtgcacctgcgctttggcaacgtcgcccgtggcggcttgcgc
tggtccgaccgcgaagaggacttccgtaccgaagtactgggcctggtaaaagcccagcag
gtaaaaaactcggtcatcgtgccggttggcgccaagggcggcttcctgccgcgccgcctg
ccactgggtggcggccgtgatgagatcgccgccgagggcgtggcgtgctaccgaatcttc
atttccggcctgctcgacatcaccgacaacctcaaggacggcggcgtggtgccaccggcc
aacgtggtgcgccatgacgatgacgacccgtacctggtggtggcggccgacaaaggcacg
gcaaccttctccgacatcgccaacggcatcgccatcgactacggcttctggctgggcgac
gcctttgcctcgggcggttcggccggttacgaccacaagaagatgggcattaccgcacgc
ggcgcctgggtgggcgtgcagcgccacttccgcgagcgcggcatcaacgtgcaggaagac
ccgatcaccgtgatcggcgtgggcgacatggccggcgacgtattcggcaacggcctgctg
atgtccgacaagctgcaactggtggcagccttcaaccatctgcacatcttcattgacccg
aacccggagcctgcgtccagctttgccgagcgcaagcgcctgttcgacctgccgcgttcg
gcctggagcgactacgacaccagcatcatgtccgaaggcggcgggatcttcccccgcagc
gccaaaagcatcgccatcagcccgcagatgaaagagcgcttcgccatcgaagccgaccgc
ctcaccccgaccgagctgctcaacgcgctgctcaaggcaccggtcgacctgctgtggaac
ggcggcattggtacctacgtgaaggccagcaccgaaagccacgccgatgtcggcgacaag
gccaacgacgcgctgcgggtcaacggcaacgaactgcgctgcaaggtggtgggcgagggc
ggcaacctgggcatgacccagcttggccgggtcgagttcggcctgaacggcggcgccacc
aacaccgactttatcgacaacgccggcggcgtggactgctccgaccacgaggtcaacatc
aagatcctgctcaacgaagtggtgcagggtggcgacatgaccgagaagcagcgcaaccag
ctgctcggcagcatgaccgacgaagtggccggcctggtgctgggcaacaactacaagcag
acccaggcgctgtcgctggcggctcgccgtgcccgtgagcggattgccgagtacaagcgc
ctgatggccgacctggaagcccgtggcaagctggaccgcgccatcgagttcctgccgtcc
gaagagcaactggccgaacgcctggctgctggccatgggctgacccgcgccgagctgtcg
gtgctgatttcgtacagcaagatcgacctcaaggaacagctgctgaaatcgctggtgccg
gacgacgactacctgacccgcgacatggaaaccgccttcccgccgtcgctggtgagcaag
tttgcccactccatgcgccgccaccgcctgaagcgcgaaattgtcagcacccagattgcc
aacgacctggtcaacaacatgggcatcactttcgtccagcgcctgaaggagtcgactggc
atgagcccggccaacgtggccggggcctatgtgatcgtgcgcgacatcttccacctgccg
cactggttccgccagatcgaggcactggactaccaggtgccggcagaaatccagctcacc
ctgatggacgaactgatgcgcctgggccgccgtgccacgcgctggttcctgcgcagccgc
cgcaacgagcaggacgccgggcgtgataccgcgcactttgggccgaagatcgcgcaactc
gggctcaagctcgatgagctgctcgaaggcccgacccgcgaacgctggatggtgcgctac
cagggctttgtcgacgcgggtgtgccagaactgctggcgcgcatggtggcgggtaccagc
cacctgtacaccctgctgccgatcatcgaagcggccgacgtcaccggtcacgaccccgcc
caggtggccaaggcgttcttcgccgtgggcagctcgctggacctgacctggtacttgcag
gaaatcagcaacttgccggtggagaacaactggcaggcgctggcccgcgaagccttccgc
gacgacatcgacctgcagcagcgggcgatcaccatttcggtgctgcagatggccgatgcg
ccggatgacatggacgcccgcgtggcactgtgggccgagcagcatcgggtgatggtagag
cgctggcgtgccatgctggacgacctgcgcaatgccaccggcaccgactatgcgatgtac
gcggtggccaaccgcgagctggtcgacctggccatgagcgggcaggcgacggtggtgccg
tcctga

DBGET integrated database retrieval system