KEGG   Pseudomonas putida NBRC 14164: PP4_37980Help
Entry
PP4_37980         CDS       T02707                                 

Definition
putative aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PP4_37980
Enzymes [BR:ppun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PP4_37980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4326329..4327111
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALADNTYTARQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGRGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIAKAIGDKRAIL
LSHHGLLIAGGSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcatacccccaaggaccagttggtcaaactcgcccagcagcagatg
ctgacggccctggccgacaacacctacacggcccggcaaaaacttgcccttacctgccgc
atcctgttcgacggcggccacgactctggccttgccgggcagatcaccgcacgtgcgcag
gaacctggcacctactacacccagcaactgggcctgggcttcgatgaaatcgccgcctca
aacctgctggtggtggacgaagacctcaccgtgctgcaaggccgcggcatggccaatccg
gccaaccgtttccacagctggctgtaccgggcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgctgccctgtcgatgctggaggtgccgctggccatctcgcac
atggacctgtgcccgctatttgacgattgcgcattcctcaaggaatggccaggggtgccg
gtgggcaacgaggaaggtgaaatcatcgcgaaggcgatcggtgacaagcgtgcgatcctg
ctttcgcaccacggcctgttgattgccggtggctcgatcgaagaagcctgcgtacttgcc
ctgctgttcgagcgcgcagcaaagatgcaattgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaagcccacgactggatctccacccccaaacgtcac
ggcgccgcgttcagctactacgcacgccgggccttgcgtgcccacggcgactgcctgggc
tga

DBGET integrated database retrieval system