KEGG   Pseudomonas putida NBRC 14164: PP4_39120Help
Entry
PP4_39120         CDS       T02707                                 

Gene name
alaA
Definition
alanine aminotransferase AlaA
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PP4_39120 (alaA)
   01230 Biosynthesis of amino acids
    PP4_39120 (alaA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP4_39120 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    PP4_39120 (alaA)
Enzymes [BR:ppun01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PP4_39120 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     PP4_39120 (alaA)
Amino acid related enzymes [BR:ppun01007]
 Aminotransferase (transaminase)
  Class I
   PP4_39120 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4453264..4454475
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKEIEGVTIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSRELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHALSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLRTYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcgcctgatgaaatcctccaggatgtgatccgcaat
ctgcctaccgcccagggctacagcgactccaaaggcctgttcagcgcacgcaaggccgtg
atgcagtactgccagcaaaaggaaatcgaaggcgtcactatcgaggacatctacctcggt
aacggtgtgtccgagctgatcgtcatgtcgatgcaggcgctgctgaacaacggcgacgaa
gtgctgatcccggcccccgactacccgctgtggactgccgcagtgagcctggctggcggc
aagccggtgcactacctgtgcgatgaacaggccgactggttccccgaccttgaagacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtgtactccagggagctgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctgtacgacgaagccgtgcacatc
agcaccgcctcgctggcccccgacctgctgtgcctgaccttcaacggcctgtccaagtcg
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
ctaagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcactgggcggctaccagagcatcaacgacctggtgctg
ccgccaggccgcctgcttgagcaacgcaaccgtacctacgagctgctcaacgacatcccg
ggcgtaagctgtgtgaagccgatgggtgcgctgtatgcgttcccccggatcgacccgaag
gtgtgcccgattctcaacgacgaaaagttcgcccttgacctgctgctgtcggaaaagctg
ctgatcgtacaaggtacggcgttcaactggccgtggccggaccacttccgcgttgtgacc
ttgccgcgggtggatgacctggaagcggcgattggccggatcggcaatttcctgcggact
tattcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system