KEGG   Pseudomonas putida NBRC 14164: PP4_39120Help
Entry
PP4_39120         CDS       T02707                                 

Gene name
alaA
Definition
alanine aminotransferase AlaA
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ppun01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppun01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppun00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ppun00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4453264..4454475
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKEIEGVTIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSRELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHALSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLRTYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcgcctgatgaaatcctccaggatgtgatccgcaat
ctgcctaccgcccagggctacagcgactccaaaggcctgttcagcgcacgcaaggccgtg
atgcagtactgccagcaaaaggaaatcgaaggcgtcactatcgaggacatctacctcggt
aacggtgtgtccgagctgatcgtcatgtcgatgcaggcgctgctgaacaacggcgacgaa
gtgctgatcccggcccccgactacccgctgtggactgccgcagtgagcctggctggcggc
aagccggtgcactacctgtgcgatgaacaggccgactggttccccgaccttgaagacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggcgcggtgtactccagggagctgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctgtacgacgaagccgtgcacatc
agcaccgcctcgctggcccccgacctgctgtgcctgaccttcaacggcctgtccaagtcg
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
ctaagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcactgggcggctaccagagcatcaacgacctggtgctg
ccgccaggccgcctgcttgagcaacgcaaccgtacctacgagctgctcaacgacatcccg
ggcgtaagctgtgtgaagccgatgggtgcgctgtatgcgttcccccggatcgacccgaag
gtgtgcccgattctcaacgacgaaaagttcgcccttgacctgctgctgtcggaaaagctg
ctgatcgtacaaggtacggcgttcaactggccgtggccggaccacttccgcgttgtgacc
ttgccgcgggtggatgacctggaagcggcgattggccggatcggcaatttcctgcggact
tattcgcagtaa

DBGET integrated database retrieval system