KEGG   Pseudomonas putida NBRC 14164: PP4_42420Help
Entry
PP4_42420         CDS       T02707                                 

Gene name
dsbC
Definition
thiol--disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppun  Pseudomonas putida NBRC 14164
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4813901..4814644)
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAVAAATDSNAVAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERMGVAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSPGDQQLQAVWCS
SDRRGAMDKMVEGEEIKAAKCANPVGKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtaccttcgctgtt
gccgcggcaaccgatagcaacgccgtcgccgagcaggccatccgcaaatcgctgcaaaac
ctcgagctggaagtgcccgtcgaaagcgtggccagcagcccgctgaacggcctgtatgaa
gtcaagctgcagggcggccgcgtgctgtacgccagcgccgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgagaaaaccgagcgt
atgggcgtcgccaagctcatcaacggcattccagcggccgagatggtggtttatcctgcc
aagggcgagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtattgccac
aagctgcacgccgaagtgcccgagctgaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgccaggggctgggctcgccgggtgaccagcagttgcaggctgtgtggtgctcc
agcgatcgccgtggggcgatggacaagatggtcgaaggtgaagagatcaaggccgccaag
tgcgccaacccggtcggcaagcagttccagttggggcagtcgatcggcgtaaatggcacg
ccggccatcgtccttgaaagcggccaggtcattccgggctaccagccggcaccgcaagtc
gccaagctggcacttgccaagtaa

DBGET integrated database retrieval system