KEGG   Pseudomonas putida NBRC 14164: PP4_45840Help
Entry
PP4_45840         CDS       T02707                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP4_45840 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PP4_45840 (proB)
Enzymes [BR:ppun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PP4_45840 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5200283..5201401)
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTSRPSAMNELQAAAALGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPTLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSDGIESILGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgtgaagattggcagtgctctgctg
accgctgatggcaagggcctcgaccgcggtgccatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcaggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggttggacttcgcgaccgagcgcgatgaacgagctgcaggccgctgcc
gcgctcggccagatgcgcctggtgcaggcctgggagtcgagcttcggcgaacacggcaag
cacaccgcgcaaatcctgctgacccatgacgacctgtccgaccgcaagcgttacctgaac
gcccgcagcaccctgcgcaccttggtcgacctgggcgtggtgccggtgatcaacgaaaac
gacaccgtggtcaccgacgaaatccgcttcggcgacaacgacaccctggcagcgctggtg
gccaacctggtcgaggccgacctgctggtgatcctcaccgaccgcgatggcatgttcgac
gccgacccgcgcaacaaccccgaagcccagctgatctacgaagcccgggccgacgatccg
acgctggatgccgtggccggtggtaccggtggtgccctgggccgtggcggcatgcagact
aaactgcgcgccgcgcgcctggccgcccgttccggtgcccacaccatcatcatcggtggc
cgcatcgagcgcgtgctggaccgcctcaaggcgggcgagcgcctgggtaccttgctgtcg
cccgagcgcggcatgctcgctgcgcgcaagcagtggctggctggccacctgcagacccgt
ggcaccctggtgctggatgccggcgccgtgcaggcgctgcgccaggccaacaagagcctg
ttgccggttggcgtgaagaccgtgcagggcagcttccgtcgtggcgagatggtggtgtgc
gttggcccggacggtgttgaagtggcccgcgggttggccaactacagcgccctggaggcg
cagaagatcatcggtcagtcgtccgatggtatcgagtcgatcctcggctatagcgctgag
cccgagctggtacaccgtgacaatctggtgctggtatga

DBGET integrated database retrieval system