KEGG   Pseudomonas putida NBRC 14164: PP4_50490Help
Entry
PP4_50490         CDS       T02707                                 

Definition
putative oxidoreductase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP4_50490
   00330 Arginine and proline metabolism
    PP4_50490
   00340 Histidine metabolism
    PP4_50490
   00350 Tyrosine metabolism
    PP4_50490
   00360 Phenylalanine metabolism
    PP4_50490
   00380 Tryptophan metabolism
    PP4_50490
Enzymes [BR:ppun01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     PP4_50490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5715426..5717270)
Genome map
AA seq 614 aa AA seqDB search
MAAAWVRLCALVLIGVSSGAALAKDKTPTAIVVGGGLAGLTAAYELQNKGWQVTLLEAKS
GMGGRSGLATSEWIGNAKAQPVLNQYLDRFKLETLPAPEFVRTPGYLIDGEYFSATDLAT
KQPATAEALKRYEKTLDDLARSIDDPLNPQATSTLFALDQINVSTWLDKLQLPATARQLV
NQQIRTRYDEPSRLSLLYFAQQNRVYRGVSDRDLRAARLPGGSPVLAQAFVKQLKTIKTS
SPVTAIVQDKDGVTVKVGSVGYQADYLVMAVPLRALAKIQMTPGLDTQHVAALRGTNYGW
RDQLMLKFKKPVWESRARMSGEIFSNAGLGMLWIEPALKGGANVVINLSGDNARLLQAFG
DKQMVDQVLIRLHAFYPQARGAFTGYEVKRYSTDAGTGGAYLAYGPGQISKYWRLWERPV
QRITFAGEHTDALYPGTLEGALRSGQRAASQAQDLLAGKSFDPAKAVPVAAAGAAAAKDS
KGGFFSNMFGGSSDKADKADKPPVKAEPKQAEEARQDKPGFFKRLFGGADTPEVKAEPIA
KAEEVAPAPAPAPQAAPAPAAPAPVIKEAAAKPAATKAAPTKHAPAHKPAETRKATAKSE
PTKKPVANTQAKAG
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcttgggtgcgcctgtgcgcgttggtattgattggtgtctccagcggcgcc
gcgctggctaaggacaagacgcccacggcgattgtcgtgggtggcggcctggcgggcctg
acggcagcgtacgagctgcagaacaaaggctggcaggtgaccctgctggaggccaagtcg
ggcatgggcgggcgttcgggcctggccaccagcgagtggatcggcaatgccaaggcgcag
ccggtgctcaaccagtaccttgaccgtttcaagctagaaacactgccagcaccggagttc
gtgcgtacccccggttacctgatcgacggtgagtacttcagcgccaccgacctggccacc
aagcaaccggctaccgccgaagcgctcaagcgctacgagaaaacccttgatgacctggcc
cgttcgatcgatgacccgctgaacccgcaggcgaccagcacgctgttcgccctcgaccag
atcaacgtctccacctggctggacaaacttcaactgccggccaccgcccgtcagttggtc
aaccagcagatccgtacccgttacgatgaaccgtcgcgcctgtcgctgctgtatttcgcc
cagcagaaccgtgtgtaccgcggtgtcagcgaccgtgacctgcgtgccgcgcgcctgccc
ggtggcagcccggtgctggcccaggccttcgtcaagcagctgaagaccatcaagaccagc
tcgccggtcaccgccatcgtccaggacaaggatggcgtaacggtaaaagtcggtagcgtt
ggctaccaggcggattacctggtcatggccgtgccgctgcgtgccctggccaagatccag
atgaccccgggcctggacacccagcacgtggcagcgctcagaggcaccaactatggctgg
cgcgaccagctgatgctcaagttcaagaagcctgtgtgggaaagccgcgcgcgcatgtcg
ggcgaaatcttcagcaacgccggcctcggcatgctgtggatcgagccagcgctcaagggc
ggcgccaacgtggtgatcaacctttccggggacaacgcccgcctgctgcaggcgttcggc
gacaagcagatggtcgatcaggtgttgatccgcctgcatgcgttctacccgcaggcccgt
ggtgccttcaccggttacgaggtcaagcgctacagcactgacgccggtaccggcggcgct
tacctggcctacggcccggggcagatcagcaaatactggcgcctgtgggagcgcccggtg
cagcgcatcacctttgccggtgaacacaccgatgccctgtacccgggcaccctggaaggc
gccctgcgcagtggccagcgtgcggccagccaggcacaggacctgttggccgggaagtcg
ttcgaccccgccaaggcggtgccggttgcggcggcaggggccgcggcagccaaggatagc
aagggcgggttcttctccaatatgttcggtggttcgtccgacaaggccgacaaggctgac
aaaccgccggtcaaggctgagccgaagcaggccgaagaggccaggcaggacaagccaggt
ttcttcaaacgcctgtttggcggggcggatacgccagaggtgaaggctgagccaatcgcc
aaggcagaggaagtggcgccggcacctgcgcctgctccccaggccgcgccggctccggca
gcacctgcacctgtcatcaaggaagcggctgccaagcctgcggcaaccaaggccgccccg
accaagcatgcgccggcgcacaagcctgccgaaaccaggaaggcaactgccaaatccgag
ccgaccaagaaacctgtggccaatacccaggccaaggctggctga

DBGET integrated database retrieval system