KEGG   Pseudomonas putida H8234: L483_00805Help
Entry
L483_00805        CDS       T02706                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pput  Pseudomonas putida H8234
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    L483_00805
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L483_00805
   00310 Lysine degradation
    L483_00805
Enzymes [BR:pput01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     L483_00805
    2.6.1.48  5-aminovalerate transaminase
     L483_00805
Amino acid related enzymes [BR:pput01007]
 Aminotransferase (transaminase)
  Class III
   L483_00805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
180849..182126
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKHPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKARDKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAELA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtt
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtactgaacaccggccacctgcac
ccgaaagtggttgcagccgtgcaagagcagctgaccaaagtcagccacacctgcttccag
gtgctggcctacgaaccctacgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgctgccactggccgtgctggcgtcatcgccttcaccggcggctaccac
ggccgtaccatgatgacgctgggcctgaccggcaaggtcgtgccgtactccgctggtatg
ggcctgatgccaggcggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccattgcttcggtcgagcgcatcttcaagaacgacgccgagccgcgtgac
atcgccgcgatcatcctcgagccggtacaaggcgaaggcggcttcctgccagcgccgaaa
gagctgatgaagcgcctgcgcgcgctgtgcgaccagcacggcatcctgctgatcgccgac
gaagttcagacgggtgctggccgtaccggtaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgagtacatggacgccatcgccccgggcggcctgggcggcacctacgcc
ggttcgccgatcgcttgcgccgcggccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtaggtgagcgcctgaccgctggcctgcgcgaaatccag
aagaagcacccgatcatcggcgacgtccgtggtctgggctcgatgattgctgttgaagtc
ttcgagaaaggcactcacaccccgaacgctgctgctgttggccaggttgttgccaaggca
cgcgacaagggtctgatcctgctgtcctgcggcacctacggcaacgttctgcgtatcctg
gtaccgctgactgccgaagacgcactgctggacaaaggcctggccatcatcgaagagtgc
ttcgctgaactcgcttga

DBGET integrated database retrieval system