KEGG   Pseudomonas putida H8234: L483_02475Help
Entry
L483_02475        CDS       T02706                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
pput  Pseudomonas putida H8234
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:pput00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pput00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
526757..528196
Genome map
AA seq 479 aa AA seqDB search
MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNRENIPERRVHAKGSGAY
GTFTVNRDITRYTCAKLFEQVGKQTETFLRFSTVGGERGSADTERDPRGFAVKFYTEEGN
WDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMMWDFWSHSPEALHQVTILFSD
RGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQGIKNLAPADAARLAGTDPDYAQ
RDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFDVTKTWSQKDYPLIEVGVLELNRNP
LNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVFAYADAHRYRVGTNHQHLPVNAPRCAV
NSYQRDGSMATGSYGSAPNYEPNSYAEAPKQSPRHAEPPLALNGSAARFDHREDTDYFSH
AGALFRLMSEGQKALLISNIAGTMAGVSEDVIQRQLQYFFKADPAYGEGIAKALGINLA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattcttaccaccgccagcggtgcacccgtagccgacaaccagaactcccgt
tccgccggcccgcgtggcccgttgttgctcgacgacttccacctgatcgagaagctcgcc
catttcaaccgcgagaacattcctgagcgccgtgtgcacgccaaaggctcgggcgcctac
ggcacctttaccgtcaatcgcgacatcacccgctacacctgcgccaagctgtttgagcag
gtcggcaagcaaacagaaaccttcctgcgcttctccactgtcggtggcgaacgtggctct
gcagacaccgaacgcgaccctcgtggctttgccgtcaagttctacaccgaagaaggcaac
tgggacattgtgggtaataacacgccagtgttctttattcgcgatccgctgaaattcccc
gactttatccacacccagaagcgccatccgcagtccaacctgaagaacgcccagatgatg
tgggatttttggtcacactcgcccgaggcgctgcaccaggtcaccatcctgttctcggac
cgtggtattccggacggctatcggcatatgcacggcttcggcagccacacgtacagtttg
atcaacgccaagggcgagcgtacctgggtcaaatggcatttcaagacccagcaaggcatc
aagaacctcgcgccggcagatgctgcacgcctggcgggtactgacccggactacgcccag
cgcgacctgttcgaagccattgaacgtggcgactacccgcgttggaccgtatgcattcag
gtgatgagcgaagccgaggctgccagccgagacgagaaccccttcgacgtcaccaagacc
tggtcgcagaaggattatccgttgatagaggtgggcgtgctggagctcaaccgtaacccg
ctcaactacttcgccgaagtcgagcaggctgcgttcgggccgagcaacatggtgccaggg
gttggcctgtcgcctgaccgcatgctgcagggccgtgtattcgcctacgcagacgcgcac
cgctaccgtgtgggcaccaaccaccagcacttgcctgtgaatgcgccacgctgcgcagtc
aacagctaccagcgcgatggctccatggccacgggcagctatgggagtgcccctaactac
gagcccaacagctacgctgaggcgccgaagcagtcaccacgccatgccgagccacccctg
gctctgaacggttcggcagcccgtttcgatcaccgtgaggacaccgactacttcagccat
gccggcgcgctgttccgcctgatgagcgaagggcagaaggcgttgctgatcagcaatatc
gccgggaccatggcaggtgtcagcgaagacgtgatccagcgccagttgcagtacttcttc
aaggctgacccggcctatggcgaaggcattgccaaggcgttgggcatcaacctggcctga

DBGET integrated database retrieval system