KEGG   Pseudomonas putida H8234: L483_05225Help
Entry
L483_05225        CDS       T02706                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pput  Pseudomonas putida H8234
Brite
Enzymes [BR:pput01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     L483_05225
Secretion system [BR:pput02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   L483_05225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135263..1136006
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAVAAATDSNAVAEQAIRKSLQNLELEVPVESVASSPLNGLYE
VKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGVAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSPGDQQLQAVWCS
SDRRGAMDKMVEGEEIKAAKCANPVGKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgtt
gccgcggcaaccgacagcaatgccgtggccgagcaggccatccgcaaatcgctgcagaac
ctcgagctggaagtaccagtagaaagcgtggccagcagcccgctcaacggcctgtatgaa
gtcaagctgcagggcggccgcgtgttgtatgccagcgccgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgagaagaccgaacgc
caaggggttgccaaactcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtattgccac
aaattgcacgccgaagtgcccgagttgaaccgtcgcggtatcgaagtgcgctatgtcgcc
ttcccgcgccaagggctcggctcgccgggtgatcagcagttgcaggcggtgtggtgctcc
agtgaccgccgcggggcgatggacaagatggtcgaaggtgaagagatcaaggccgccaag
tgcgccaacccggtcggcaagcaattccagctgggccagtcgatcggcgtcaacggcacg
ccggctatcgtcctcgaaagcggccaggtcattccgggctaccagccggcaccgcaggtc
gccaagctggcacttgccaagtaa

DBGET integrated database retrieval system