KEGG   Pseudomonas putida H8234: L483_06875Help
Entry
L483_06875        CDS       T02706                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pput  Pseudomonas putida H8234
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    L483_06875
   01230 Biosynthesis of amino acids
    L483_06875
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L483_06875
   00290 Valine, leucine and isoleucine biosynthesis
    L483_06875
Enzymes [BR:pput01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     L483_06875
    2.6.1.66  valine---pyruvate transaminase
     L483_06875
Amino acid related enzymes [BR:pput01007]
 Aminotransferase (transaminase)
  Class I
   L483_06875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493187..1494398)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKEIEGVTIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSRELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHALSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLRTYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctatgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccagcgccgtttggcttcgaggcgcccgatgaaatcctccaggatgtgatccgcaac
ctgcccaccgcgcagggctacagcgactccaaaggcctgttcagcgcacgcaaggccgtg
atgcagtactgccagcagaaggaaatcgaaggcgtcaccattgaggacatctacctcggt
aacggcgtttccgagctgattgtcatgtcgatgcaggcgctgctgaacaacggcgacgaa
gtgctgatcccggcccccgactacccgctgtggacggccgccgtaagcctggccgggggc
aagccggtgcactacctgtgcgacgagcaggccgactggttccccgaccttgaagacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggggcggtgtactccagggagctgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctccgacgaaatctacgacaagattttgtacgatgaagcggtacacatc
agcaccgcctcgctggcaccagacctgctgtgcctgactttcaacggcctgtccaagtct
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
ctcagctacatcgaaggcatcgacatgctggcgaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcactgggcggctaccagagcatcaacgacctggtgctg
ccgccaggccgcctgctggagcagcgcaaccgtacctacgagctgctaaacgatatcccg
ggtgtaagctgcgtgaagccgatgggtgcgctgtatgccttcccgcggatcgacccgaag
gtgtgcccgatcctcaacgacgagaagttcgccctggacctgctgctgtcggaaaagctg
ctgatcgtacaaggtacggcgttcaactggccgtggccggaccacttccgcgtggtgacc
ttgccgcgggtggatgacctggaagcggcgattggccggatcggcaatttcctgcggacg
tattcgcaataa

DBGET integrated database retrieval system