KEGG   Pseudomonas putida H8234: L483_06875Help
Entry
L483_06875        CDS       T02706                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pput  Pseudomonas putida H8234
Pathway
pput00220  Arginine biosynthesis
pput00250  Alanine, aspartate and glutamate metabolism
pput00290  Valine, leucine and isoleucine biosynthesis
pput01100  Metabolic pathways
pput01110  Biosynthesis of secondary metabolites
pput01130  Biosynthesis of antibiotics
pput01210  2-Oxocarboxylic acid metabolism
pput01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L483_06875
   00290 Valine, leucine and isoleucine biosynthesis
    L483_06875
   00220 Arginine biosynthesis
    L483_06875
Enzymes [BR:pput01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     L483_06875
    2.6.1.66  valine---pyruvate transaminase
     L483_06875
Amino acid related enzymes [BR:pput01007]
 Aminotransferase (transaminase)
  Class I
   L483_06875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGN78297
UniProt: R9V0E0
Position
complement(1493187..1494398)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKEIEGVTIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSRELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHALSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLRTYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctatgacattcgcggcccagtg
ctcaagcacgccaagcgcctggaagaggaaggccaccgcatcctcaagctgaacatcggc
aacccagcgccgtttggcttcgaggcgcccgatgaaatcctccaggatgtgatccgcaac
ctgcccaccgcgcagggctacagcgactccaaaggcctgttcagcgcacgcaaggccgtg
atgcagtactgccagcagaaggaaatcgaaggcgtcaccattgaggacatctacctcggt
aacggcgtttccgagctgattgtcatgtcgatgcaggcgctgctgaacaacggcgacgaa
gtgctgatcccggcccccgactacccgctgtggacggccgccgtaagcctggccgggggc
aagccggtgcactacctgtgcgacgagcaggccgactggttccccgaccttgaagacatc
aaggccaagatcaccccgaacaccaaggccctggtgatcatcaacccgaacaacccgacc
ggggcggtgtactccagggagctgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctccgacgaaatctacgacaagattttgtacgatgaagcggtacacatc
agcaccgcctcgctggcaccagacctgctgtgcctgactttcaacggcctgtccaagtct
taccgggtggcgggcttccgttccggctggctgatcatctccgggcccaagcaccacgcg
ctcagctacatcgaaggcatcgacatgctggcgaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcactgggcggctaccagagcatcaacgacctggtgctg
ccgccaggccgcctgctggagcagcgcaaccgtacctacgagctgctaaacgatatcccg
ggtgtaagctgcgtgaagccgatgggtgcgctgtatgccttcccgcggatcgacccgaag
gtgtgcccgatcctcaacgacgagaagttcgccctggacctgctgctgtcggaaaagctg
ctgatcgtacaaggtacggcgttcaactggccgtggccggaccacttccgcgtggtgacc
ttgccgcgggtggatgacctggaagcggcgattggccggatcggcaatttcctgcggacg
tattcgcaataa

DBGET integrated database retrieval system