KEGG   Pseudomonas putida H8234: L483_07645Help
Entry
L483_07645        CDS       T02706                                 

Definition
glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
pput  Pseudomonas putida H8234
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    L483_07645
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L483_07645
   00330 Arginine and proline metabolism
    L483_07645
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    L483_07645
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     L483_07645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1654852..1659717
Genome map
AA seq 1621 aa AA seqDB search
MAFFTAASKADFQHQLQAALAQHISEQSLPQVALFAEQFFGIISLDELTQRRLSDLAGCT
LSAWRIIERFDPEYPQVRVYNPDYERNGWQSTHTVVEVLHHDLPFLVDSVRTELNRRGYS
IHTLQTTVLSVRRGAKGELLELLPKGTQGEGVRHESLMYLEIDRCANAAELTVLTREIEQ
VLAEVRVAVADFEPMKAKLREVVAQVEQTAFGPAQNEKGEVKAFLEWLLDNHFTFLGYEE
FTVKRDADGGQMVYDEQSFLGLPRRLRVGLTAEELRIEDYAVAYLNEPLLLSFAKAALPS
RVHRPAYPDYVSIRQLDADGRVIKEHRFMGLYTSSVYGESVHAIPYIRVKVAEVERRSGF
DAKAHLGKELAQVLEVLPRDDLFQTPIDELFTTVMAIVQIQERNKIRVFLRKDPYGRFCY
CLAYVPREIYSTEVRQKIQQVLMERLKASDCEFWTFFSESVLARVQLILRVDPKNRIDID
PQQLEREVIQACRSWQDDYSTLVVENFGEAQGTNILADFPKGFPAGYRERFAAHSAVVDL
QHVLNLSESKPLAMSFYQPLTQVGERILHCKLYHADTPLALSDVLPILENLGLRVLGEFP
YRLRHANGREYWIHDFAFTYSEGLSLDIQQLNDTLQDAFIHIVGGDAENDAFNRLVLTAG
LPWRDVALLRAYARYMKQIRLGFDLGYIASTLNNHTDIARELTRLFKTRFYLARKLTQDD
LDDKQLRLEQAILTALDDVQVLNEDRILRRYLDLIKATLRTNFYQPDTNGQNKSYFSFKF
NPKLIPELPKPVPKFEIFVYSPRVEGVHLRFGNVARGGLRWSDREEDFRTEVLGLVKAQQ
VKNSVIVPVGAKGGFLPRRLPLGGSRDEIAAEGVACYRIFISGLLDITDNLKDGGVVPPA
NVVRHDDDDPYLVVAADKGTATFSDIANGIAIDYGFWLGDAFASGGSAGYDHKKMGITAR
GAWVGVQRHFRERGINVQEDPITVIGVGDMAGDVFGNGLLMSDKLQLVAAFNHLHIFIDP
NPEPASSFAERKRLFDLPRSAWSDYDTSIMSEGGGIFPRSAKSIAISPQMKERFAIEADR
LTPTELLNALLKAPVDLLWNGGIGTYVKASTESHADVGDKANDALRVNGNELRCKVVGEG
GNLGMTQLGRVEFGLNGGATNTDFIDNAGGVDCSDHEVNIKILLNEVVQGGDMTEKQRNQ
LLGSMTDEVGALVLGNNYKQTQALSLAARRARERIAEYKRLMADLEARGKLDRAIEFLPS
EEQLAERLAAGQGLTRAELSVLISYSKIDLKEQLLKSLVPDDDYLTRDMETAFPPSLVSK
FADSMRRHRLKREIVSTQIANDLVNNMGITFVQRLKESTGMSPANVAGAYVIVRDIFHLP
HWFRQIEALDYQVPAEVQLTLMDELMRLGRRATRWFLRSRRNEQDAGRDTAHFGPKVAQL
GLKLDELLEGPTRERWMVRYQGFVDAGVPELLARMVAGTSHLYTLLPIIEAADVTGHDPA
QVAKAFFAVGSALDLTWYLQEISNLPVENNWQALAREAFRDDIDLQQRAITISVLQMADA
PDDMDARVALWAEQHRVMVERWRAMLDDLRNATGTDYAMYAVANRELVDLAMSGQAAVVP
S
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcttcaccgcagccagcaaagccgacttccagcatcaactgcaagcggccctg
gcgcagcacatcagcgaacagtccctgccacaagtggcgctgttcgccgagcagttcttc
ggcatcatctctctggacgaactcacccaacgcaggctttccgacctggccggctgcacc
ctgtcagcctggcgcatcatcgagcgtttcgaccccgaatacccgcaagtgcgggtgtat
aaccctgattacgaacgcaacggctggcaatcgacccataccgtggtcgaagtgctgcac
cacgacctgccgttcctggtcgactcggtgcgcaccgagctcaaccgccgcggctacagc
atccataccctgcaaaccaccgtgctcagcgtgcgccgtggcgccaagggcgagctgctg
gagctgctgcccaagggcacacagggcgagggtgtgcgccatgagtcgctgatgtacctg
gagatcgaccgttgcgccaatgccgccgaactgaccgtgctgacccgcgagatcgagcag
gtgctggccgaggtacgggtggccgtggccgacttcgaaccgatgaaggccaagctgcgt
gaagtggtggcgcaggtggagcagaccgcctttggtcctgcccagaacgagaagggcgag
gtcaaagccttcctcgagtggctgctggacaaccatttcaccttcctgggctatgaagaa
ttcaccgtcaagcgtgacgccgacggcggccagatggtctacgacgagcagtcgttcctc
ggcctgccgcgccgcctgcgcgtggggctcacggccgaagagctgcgcatcgaagactac
gccgtggcctacctcaacgaaccactgttgctgtcgttcgccaaggccgcactgcccagc
cgcgtgcaccgcccggcctacccggactacgtgtcgatccgccagctggacgccgacggc
agagtcatcaaggaacaccgcttcatgggcctgtacacctcttcggtgtatggcgaaagc
gtgcatgccattccgtacatccgtgtgaaggtggctgaagtcgagcgccgttcgggcttc
gacgccaaggcccacctgggcaaggaactggcccaggtgctggaagtgctgccgcgcgac
gacctgttccagacgccgatcgacgagctgttcaccaccgtcatggcgatcgtgcagatc
caggagcgcaacaagatccgcgtgttcctgcgcaaggacccttacggccgcttctgctac
tgcctggcctacgtcccgcgggaaatctactccaccgaagtgcggcagaagatccagcag
gtgctgatggagcgcctgaaggccagcgactgcgaattctggaccttcttctccgagtcg
gtgctggcacgcgtgcagctgattttgcgggtagacccgaaaaaccgcatcgacatcgac
ccgcagcagctggaacgcgaagtgatccaggcttgccgctcgtggcaagacgactactcg
accctggtggtcgagaactttggtgaagcccaaggcaccaacatcctggccgatttcccc
aagggcttcccggccgggtaccgtgagcgcttcgccgcgcactcggcggtggtcgacctg
cagcacgtgctgaacctgtcggaaagcaagccgctggcgatgagcttctaccagccgctg
acccaggtgggcgagcgcatcctgcactgcaagctgtaccacgccgatacgcccctggcg
ctgtccgatgtgctgccgatcctggaaaacctcggcctgcgtgtgctcggcgagtttccg
taccgcctgcgccatgccaatggccgcgagtactggatccacgacttcgccttcacctac
agcgaaggcctgagcctggatatccagcagctcaatgacaccctgcaggacgctttcatc
cacatcgtgggcggcgatgccgagaacgatgccttcaaccggctggtgctcaccgccggc
ctgccatggcgtgacgtagcgctgttgcgcgcctacgcccgttacatgaagcagattcgt
ctgggctttgacctgggctacatcgccagcaccctgaacaaccacaccgacattgcccgc
gagctgacccggttgttcaagacccgcttctacctggcacgcaagctcacccaggacgac
ctggacgacaagcaactgcgcctggagcaagcgatcctgaccgcgctggacgacgtgcag
gtgctcaatgaagaccgcatcctgcgccgctacctggacctgatcaaggctaccctgcgc
accaacttctaccagccggacaccaacggccagaacaagtcgtacttcagcttcaagttc
aaccccaagctgatccccgaactgcccaaaccagtgcccaagttcgaaatcttcgtctat
tcgccgcgggtagagggcgtgcacctgcgctttggcaacgtcgcccgtggcggcctgcgc
tggtctgaccgtgaggaagacttccgtaccgaggtgctgggcctggtgaaagcccagcag
gtgaagaactcggtcatcgtaccggtcggcgccaagggtggcttcctgccgcgtcgcctg
ccgctgggggggagccgtgacgagatcgccgctgaaggcgtggcgtgctatcgcatcttc
atttccggcctgctcgacatcaccgacaacctcaaggacggcggcgtggtgcctccggcc
aacgtggtgcgccacgacgatgacgacccatacctggtggtggcggccgacaagggcacg
gcgaccttctccgacatcgccaacggcattgccatcgactacggcttctggctgggcgat
gcgttcgcctcgggcggctccgccggttacgaccacaagaagatgggtattaccgcgcgc
ggcgcctgggttggtgtgcaacgccacttccgcgagcgcggcatcaacgtgcaggaagac
ccgatcaccgtgattggcgtgggcgacatggccggcgacgtgttcggcaacggcctgctg
atgtccgacaagctgcaactggtggcggcgttcaaccacctgcacatcttcattgacccg
aacccggagcctgcgtccagctttgccgagcgcaagcgcctgttcgacctgccgcgttcg
gcctggagcgattacgacaccagcatcatgtccgaaggcggcgggattttcccgcgcagt
gccaagagcatcgccatcagcccgcagatgaaagagcgcttcgccatcgaagccgaccgc
ctgaccccgaccgagctgctcaacgcgttgctcaaggcaccggtcgacctgttgtggaac
ggcggcattggtacttacgtgaaggccagcaccgaaagccacgccgatgttggcgacaag
gccaacgacgcgctgcgggtcaatggcaacgaactgcgctgcaaagtggtgggtgagggc
ggcaacctgggcatgacccagctcggccgggtcgagttcggcctgaacggcggcgccacc
aacaccgacttcatcgataacgccggcggcgtggactgctccgaccacgaggtcaacatc
aagatcctgctcaacgaagtggtgcagggtggcgacatgaccgagaagcagcgcaaccag
ctgctcggcagcatgaccgacgaagtgggcgccctggtgctgggcaacaactacaagcag
acccaggcgctatcgctggcggcccgtcgtgcccgcgagcggattgccgagtacaagcgc
ctgatggccgacctggaagcccgtggcaagctggaccgtgccatcgagttcctgccgtcc
gaagagcagttggccgaacgcctggcggccggccagggcctgacccgcgccgagctgtcg
gtgctgatttcgtacagcaagatcgacctcaaggaacagctgcttaagtcgctggtgcca
gacgacgactacctgacccgcgacatggaaaccgccttcccgccgtcgctggtcagcaag
ttcgccgactccatgcgccgccaccgcctgaagcgtgaaatcgtcagcacccagatcgcc
aacgacctggtcaacaacatgggtatcaccttcgtccagcgcctgaaggagtcgaccggc
atgagcccggcgaacgtggccggggcctatgtgatcgtgcgcgacatcttccacctgccg
cactggttccgccagatcgaggcactggattaccaggtgccggcagaagtccagctgacc
ctgatggacgaactgatgcgcctgggccgccgtgccacgcgctggttcctgcgcagccgc
cgtaacgagcaggacgctgggcgtgataccgcacacttcgggccgaaagtcgcgcaactg
gggctcaagctcgatgaactgctcgaaggcccgacccgcgaacgctggatggttcgctat
caaggctttgtcgacgccggtgtgccagagttgctggcgcgcatggtggcgggtaccagc
cacctctacaccttgctgccgatcattgaagcagccgacgtcacgggccacgacccggcg
caggtggccaaggcgttctttgccgtgggcagtgcattggacctgacctggtacctgcag
gaaatcagtaacttgccggttgagaacaactggcaggcgctggcccgcgaagccttccgc
gacgatatcgacctgcagcagcgggcgatcaccatctcggtcttgcaaatggccgatgcg
ccggatgacatggacgcccgtgtggcattgtgggccgaacagcaccgggtcatggtggag
cgctggcgcgccatgctggacgacctgcgcaacgccaccggtaccgactatgcgatgtac
gcggtggccaaccgcgagctggtcgacctggccatgagcgggcaggcggcggtggtaccg
tcctga

DBGET integrated database retrieval system