KEGG   Pseudomonas putida H8234: L483_11695Help
Entry
L483_11695        CDS       T02706                                 

Definition
aldehyde dismutase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pput  Pseudomonas putida H8234
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pput00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    L483_11695
  Energy metabolism
   00680 Methane metabolism
    L483_11695
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L483_11695
Enzymes [BR:pput01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     L483_11695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2526118..2527257
Genome map
AA seq 379 aa AA seqDB search
MKAIVYNGPRDVAVKDVPDAKIEKPTDVLVRITTTNICGSDLHMYEGRTSFEAGRVFGHE
NLGEVIEVGAGVDRVKVGDRVCLPFNIGCGFCENCEKGLTGFCLTANPGAAGAAYGFADM
GPYQGGQAELLRVPYADFNCLILPEDAQEREDDYVMLSDIFPTGWHATELAGLLPGESIA
IYGAGPVGLMAAHSAIIKGASQVFVIDNQPDRLQLAAQLGATPINAVEQKAVEEIMNLTH
GKGTDRGCECVGYQCCDKHGHEANYLTMNNLVASTKATGGIGVVGVFVPEDPGAKNDLAK
EGKMAFDFGAFWFKGQQIRTGQANVKAYNRRLAELIQHGRAKPSQIISHRLKLAEGPDAY
KHFDARDDGWTKVVLKPAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcgtgtacaacggcccacgtgacgtagcggtcaaggatgtgccggacgca
aaaatcgaaaagcctacggatgtgctggtacgcatcacgacgaccaacatctgcggttct
gatttgcacatgtacgaaggccgcacctcatttgaagccgggagagtgtttggccacgaa
aatctcggtgaggtcatcgaggttggggcaggggtcgaccgggtcaaggtcggtgatcgg
gtctgcctacctttcaatatcggctgtgggttctgtgagaactgtgaaaaaggcctcact
gggttttgccttacagcgaaccctggtgctgcgggcgccgcttacggttttgccgacatg
ggcccttatcagggcgggcaggctgagctgctgcgtgtgccttatgcggacttcaactgc
ttgatactgccggaggacgcccaggagcgtgaagacgactacgtcatgctctcggatatt
tttcccaccggttggcatgcaacagaactggccggcctgcttccgggtgagagcattgcg
atttacggcgcggggcctgtcggcctgatggcggcccattcggcaatcatcaaaggcgcg
tctcaggtgttcgtcatcgacaaccaaccggatcggctgcaacttgccgcgcagctgggg
gcaaccccaatcaatgcagtcgagcaaaaagcagtcgaagagatcatgaaccttacccac
ggcaaaggcaccgaccggggctgtgagtgcgtgggctaccagtgctgcgacaagcatggc
catgaagcgaactacctcaccatgaacaacctggtcgcttccaccaaggctaccggtggc
attggcgtagtaggcgtgttcgtgcctgaagaccctggtgcgaagaacgacttggcgaaa
gagggcaagatggccttcgatttcggtgcgttctggttcaagggccagcagatccgcaca
ggtcaggcgaacgtgaaggcctacaaccgtcgtcttgcagagctcatccagcatgggcgt
gccaagccttcccagattatctctcatcgtttgaagcttgctgaaggcccagatgcctac
aagcacttcgatgcgcgggatgatggctggacgaaagtggtgctcaagcctgcggcgtga

DBGET integrated database retrieval system