KEGG   Pseudomonas putida H8234: L483_11695Help
Entry
L483_11695        CDS       T02706                                 

Definition
(RefSeq) aldehyde dismutase
Organism
pput  Pseudomonas putida H8234
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2526118..2527257
Genome map
AA seq 379 aa AA seqDB search
MKAIVYNGPRDVAVKDVPDAKIEKPTDVLVRITTTNICGSDLHMYEGRTSFEAGRVFGHE
NLGEVIEVGAGVDRVKVGDRVCLPFNIGCGFCENCEKGLTGFCLTANPGAAGAAYGFADM
GPYQGGQAELLRVPYADFNCLILPEDAQEREDDYVMLSDIFPTGWHATELAGLLPGESIA
IYGAGPVGLMAAHSAIIKGASQVFVIDNQPDRLQLAAQLGATPINAVEQKAVEEIMNLTH
GKGTDRGCECVGYQCCDKHGHEANYLTMNNLVASTKATGGIGVVGVFVPEDPGAKNDLAK
EGKMAFDFGAFWFKGQQIRTGQANVKAYNRRLAELIQHGRAKPSQIISHRLKLAEGPDAY
KHFDARDDGWTKVVLKPAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcgtgtacaacggcccacgtgacgtagcggtcaaggatgtgccggacgca
aaaatcgaaaagcctacggatgtgctggtacgcatcacgacgaccaacatctgcggttct
gatttgcacatgtacgaaggccgcacctcatttgaagccgggagagtgtttggccacgaa
aatctcggtgaggtcatcgaggttggggcaggggtcgaccgggtcaaggtcggtgatcgg
gtctgcctacctttcaatatcggctgtgggttctgtgagaactgtgaaaaaggcctcact
gggttttgccttacagcgaaccctggtgctgcgggcgccgcttacggttttgccgacatg
ggcccttatcagggcgggcaggctgagctgctgcgtgtgccttatgcggacttcaactgc
ttgatactgccggaggacgcccaggagcgtgaagacgactacgtcatgctctcggatatt
tttcccaccggttggcatgcaacagaactggccggcctgcttccgggtgagagcattgcg
atttacggcgcggggcctgtcggcctgatggcggcccattcggcaatcatcaaaggcgcg
tctcaggtgttcgtcatcgacaaccaaccggatcggctgcaacttgccgcgcagctgggg
gcaaccccaatcaatgcagtcgagcaaaaagcagtcgaagagatcatgaaccttacccac
ggcaaaggcaccgaccggggctgtgagtgcgtgggctaccagtgctgcgacaagcatggc
catgaagcgaactacctcaccatgaacaacctggtcgcttccaccaaggctaccggtggc
attggcgtagtaggcgtgttcgtgcctgaagaccctggtgcgaagaacgacttggcgaaa
gagggcaagatggccttcgatttcggtgcgttctggttcaagggccagcagatccgcaca
ggtcaggcgaacgtgaaggcctacaaccgtcgtcttgcagagctcatccagcatgggcgt
gccaagccttcccagattatctctcatcgtttgaagcttgctgaaggcccagatgcctac
aagcacttcgatgcgcgggatgatggctggacgaaagtggtgctcaagcctgcggcgtga

DBGET integrated database retrieval system